KEGG   Cupriavidus basilensis: RR42_m3722Help
Entry
RR42_m3722        CDS       T03642                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
cbw  Cupriavidus basilensis
Brite
KEGG Orthology (KO) [BR:cbw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    RR42_m3722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 CARDB
Motif
Other DBs
NCBI-ProteinID: AJG21082
UniProt: A0A0C4Y6Q1
Position
main:complement(3960741..3961124)
Genome map
AA seq 127 aa AA seqDB search
MSTMSEYAFSVAVRTQYLADQSDPERGRHAFAYTITIHNTGEVAAQLISRHWVITDSDNG
TQEVAGLGVVGHQPLLKPGEHFEYTSWATISTPVGSMKGEYFCVAEDGHRFEVPIPEFAL
VLPRMLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgacaatgagcgaatacgcgttttccgtggccgtacgtacccagtacctggccgac
cagtccgaccctgagcgcgggcgccatgccttcgcctacaccatcacgatccacaatacc
ggcgaggtggctgcgcagctgatctcccggcactgggtcatcaccgatagcgacaacggc
acccaggaagtggctggccttggcgtggtcgggcaccagcccctgctcaagccgggcgag
catttcgagtacaccagctgggccacgatctcgaccccggtgggctcgatgaagggagag
tatttctgcgtggccgaggatggccatcgcttcgaggtgccgattcccgagtttgcgctg
gtcctgccgcgcatgttgcactga

DBGET integrated database retrieval system