KEGG   Cupriavidus basilensis: RR42_m3905Help
Entry
RR42_m3905        CDS       T03642                                 

Definition
(GenBank) LSU ribosomal protein L22p (L17e)
  KO
K02890  large subunit ribosomal protein L22
Organism
cbw  Cupriavidus basilensis
Pathway
cbw03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cbw00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RR42_m3905
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cbw03011]
    RR42_m3905
Ribosome [BR:cbw03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    RR42_m3905
  Bacteria
    RR42_m3905
  Archaea
    RR42_m3905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PAS_10
Motif
Other DBs
NCBI-ProteinID: AJG21264
UniProt: A0A0C4YH68
Position
main:complement(4155109..4155438)
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPIERALNVLTFSPKKAAVIVKKVVESAIANAEH
NEGADIDELKVKTIFVDKATSLKRFTARAKGRGNRIEKQTCHITVTLGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaagcgattcatcgcggtgcccgcatctccgcccagaaaacgcgcctggtc
gctgaccagatccgcggtctgccgatcgaacgcgcgctcaacgtcctgacgttcagcccg
aaaaaggcggccgtcatcgtgaagaaggtggtcgaatcggccatcgccaacgccgagcac
aacgaaggcgccgacatcgacgaactgaaggtcaagaccatcttcgtcgacaaggcaacc
tcgctcaagcgtttcacggcacgagcaaagggccgcggcaaccgcatcgagaaacaaact
tgtcacatcactgtgacgctcggcaactaa

DBGET integrated database retrieval system