KEGG   Cupriavidus basilensis: RR42_s1515Help
Entry
RR42_s1515        CDS       T03642                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbw  Cupriavidus basilensis
Pathway
cbw00071  Fatty acid degradation
cbw00072  Synthesis and degradation of ketone bodies
cbw00280  Valine, leucine and isoleucine degradation
cbw00310  Lysine degradation
cbw00362  Benzoate degradation
cbw00380  Tryptophan metabolism
cbw00620  Pyruvate metabolism
cbw00630  Glyoxylate and dicarboxylate metabolism
cbw00640  Propanoate metabolism
cbw00650  Butanoate metabolism
cbw00900  Terpenoid backbone biosynthesis
cbw01100  Metabolic pathways
cbw01110  Biosynthesis of secondary metabolites
cbw01120  Microbial metabolism in diverse environments
cbw01130  Biosynthesis of antibiotics
cbw01200  Carbon metabolism
cbw01212  Fatty acid metabolism
cbw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RR42_s1515
   00630 Glyoxylate and dicarboxylate metabolism
    RR42_s1515
   00640 Propanoate metabolism
    RR42_s1515
   00650 Butanoate metabolism
    RR42_s1515
  Lipid metabolism
   00071 Fatty acid degradation
    RR42_s1515
   00072 Synthesis and degradation of ketone bodies
    RR42_s1515
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RR42_s1515
   00310 Lysine degradation
    RR42_s1515
   00380 Tryptophan metabolism
    RR42_s1515
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RR42_s1515
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RR42_s1515
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RR42_s1515
Enzymes [BR:cbw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RR42_s1515
Exosome [BR:cbw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RR42_s1515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III PTA_PTB
Motif
Other DBs
NCBI-ProteinID: AJG23103
UniProt: A0A0C4YJA5
Position
secondary:1655153..1656349
Genome map
AA seq 398 aa AA seqDB search
MKRAAIVSPLRTPIGAFGGSLRSIPVEELGATVARAVVERTGLDPARIEDVVFAHSYANG
EVPCTGRWVALQAGFPISVAGMQLDRRCGSGLQAIATAAMMVQTGAADVVMAGGVESMSN
VEYYTTDMRWGKRAGTVKFHDRLERGRERSQPEARFGRISGMIETAENVARDYGISREQA
DAFALRSHQRAAEAWSSGKFAQEVVPVSVAQRKGEALIVSEDEGIRGDLTIEQLARLKPL
MKDGIVTAGNACQQNDAAAACLIVAEDKLEALGLAPIGYLHSWAVAGCEPSHMGIGPVPA
VKKLFGKNGLGFDDMGLVELNEAFACQALACAKGWGWNDPDRFNVNGSGISLGHPVGATG
VRIMTSLMHELGRRGARYGLETMCIGGGQGIAAVFERA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgagccgcaatcgtctccccgctgcgcacgcccatcggcgcgttcggcggcagc
ctgcgcagtatccccgtcgaagaactcggcgctaccgtggcgcgcgccgtggtcgagcgc
acgggcctggatccggcccgtatcgaggatgtggtgttcgcccattcctacgccaacggc
gaagtgccttgcaccgggcgctgggtggcgctgcaggccggctttccgatcagcgttgcc
ggcatgcagctggatcggcgctgcggcagcggcctgcaggccatcgccacggcggcgatg
atggtgcagaccggcgccgccgatgtcgtgatggctgggggtgtcgagagcatgagcaac
gtggagtactacaccaccgacatgcgctggggcaagcgcgccggcaccgtgaagttccac
gaccgtctggagcgcgggcgcgagcgctcgcagcccgaagcccgcttcggccgcatctcc
ggcatgatcgagaccgccgagaacgtggcacgcgactatggcatctcgcgcgagcaggcc
gatgcttttgcgctgcgcagccaccagcgcgccgccgaagcgtggtccagcggcaagttc
gcgcaggaggtggtgccggtcagcgttgcgcagcgcaagggcgaggcgctgatcgtgagc
gaggacgagggcatccgcggggacctcaccatcgagcagctcgcgcggctcaagcccctg
atgaaggacggcatcgtcactgccggcaatgcctgccagcagaacgacgccgccgccgcc
tgcctgatcgtggccgaagacaagctggaagcgctcggcctggcgcccatcggctacctg
catagctgggccgtggccggttgcgagccgtcgcacatgggtatcggccccgtgccagcc
gtcaagaagctgttcggcaagaacgggctgggcttcgacgacatgggcctggtggaactg
aacgaagcctttgcctgccaggcgctggcctgcgccaagggctggggctggaacgatccg
gatcgcttcaatgtgaacgggtccggcatctcgctggggcatccggtgggcgccaccggc
gtgcgcatcatgacctcgctgatgcacgaactgggccggcgcggcgcgcgctacggcctg
gaaaccatgtgcatcggcggcgggcagggcattgcagccgtgttcgaacgcgcctga

DBGET integrated database retrieval system