KEGG   Cupriavidus basilensis: RR42_s1988Help
Entry
RR42_s1988        CDS       T03642                                 

Definition
(GenBank) FMN reductase
  KO
K00299  FMN reductase [EC:1.5.1.38]
Organism
cbw  Cupriavidus basilensis
Pathway
cbw00740  Riboflavin metabolism
cbw00920  Sulfur metabolism
cbw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbw00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    RR42_s1988
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    RR42_s1988
Enzymes [BR:cbw01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.38  FMN reductase (NADPH)
     RR42_s1988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red Flavodoxin_2 Flavodoxin_5
Motif
Other DBs
NCBI-ProteinID: AJG23576
UniProt: A0A0C4YSI0
Position
secondary:complement(2178135..2178701)
Genome map
AA seq 188 aa AA seqDB search
MATPLKVVAVNGSAQQPSRTLALVQALLTELDSRLHLQSHIVNLGDIARPLGAALSRAEL
PAEIENQLVAIESADLLVVAAPVYRGSYPGHFKHLFDLVGQQALVDKPVLLGATGGSDRH
ALVLEHQLRPLFGFLQALTLPIGVYGSPGDFHNYQVSSAALAERIRLAADRCAPLFEASR
KLPLQRAA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggctacaccgctgaaagtggtcgccgtcaacggcagcgcgcagcagccctcgcgcacg
ctcgcgctcgtgcaggcactgctcacggagctggatagccggctgcatttgcaaagccat
atcgtcaatctcggcgacatcgcgcgtccgctgggcgcggcgctgtcgcgcgcggagctg
ccggccgagattgaaaaccagctggtcgccatcgagtccgcggacctgctggtggtggcc
gcgccggtgtatcgcggttcttatcccggccacttcaagcaccttttcgacctggtgggg
cagcaagcgctggtggacaagccggtgctgctgggggcgacgggcggcagcgaccgccac
gcgctggtgctggagcatcagttgcggccgctgttcggcttcctgcaggcgctcacgctg
cccatcggcgtgtatggcagcccgggggatttccacaattaccaggtcagcagcgccgcg
ctggccgaacgcatccgcctggccgcggatcgttgcgcgccgctgttcgaggccagccgc
aaattgccgctgcagcgcgcggcttga

DBGET integrated database retrieval system