KEGG   Candidatus Symbiobacter mobilis: Cenrod_0889Help
Entry
Cenrod_0889       CDS       T02877                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
cbx  Candidatus Symbiobacter mobilis
Pathway
cbx00471  D-Glutamine and D-glutamate metabolism
cbx00550  Peptidoglycan biosynthesis
cbx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Cenrod_0889 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cenrod_0889 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbx01011]
    Cenrod_0889 (murD)
Enzymes [BR:cbx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Cenrod_0889 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:cbx01011]
 Precursor biosynthesis
  Amino acid ligase
   Cenrod_0889 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AGX86992
UniProt: U5N6J1
Position
complement(955789..957120)
Genome map
AA seq 443 aa AA seqDB search
MQALQAALPGATCLAGTLGVALVEAGEVDRIVRSPGLRPADWAALNVAAQARGIAVEGEL
SLFVQALTLLRGERGYAPIVLGVTGTNGKTTTTMLTGALIAGAGRTVAVAGNVGFPMLDT
LARHLDANTLPEVWVLELSSFQLDGMQGFAPKAAVVLNLTQDHLDWHGSMEDYARAKACI
FGARTLRVLYRHDPLVMAMQPDDLALAQTVGVDVPRQVGDYGIERVAGVDHLVRAVQGSA
GVEHALLLPCSALRIHGLHNATNALAALALAEAAGCPIGAVRDALCAYRGEPHRVEAVGQ
IADVAFFDDSKGTNVGATVAALEGLGPQRRLIVLLGGDGKGQDFAPLAEPVARYARAAIV
YGRDGAWIHSALGDSAPVYEATSLQQAVDIAGGVAQAGDAVLLSPACASFDMFDDYEHRA
RVFRDAVREWADKTGHPLQELQP
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgctgcaagccgcgttgcctggggcgacgtgccttgcgggaacgctgggggtt
gcgctcgtcgaagcgggcgaggtcgatcggatcgtccgtagcccgggactgcgcccggca
gattgggcggcactcaatgtggcagcgcaggcgcggggcattgccgtcgaaggcgagttg
tccctattcgtgcaagccctgacgctattgcgtggcgagcgcggttatgcgcccatcgtg
ctcggggtgacgggcaccaacggcaagacgacgacgacgatgctcactggcgcgttgatt
gccggggcgggccgtaccgtggccgttgcgggcaatgtaggtttccccatgctcgatacc
ttggcgcgacatctggatgcgaataccttgccggaggtgtgggtgctggagctatccagt
ttccagctcgacggcatgcaagggtttgcccccaaggcggcggtcgtactcaacctcacg
caggatcacttggactggcatgggtcgatggaggactatgcacgggccaaagcatgtatt
tttggggcgcggaccttgcgcgtgctgtaccggcatgatcccctggtcatggcgatgcag
cccgacgatcttgcgctggcgcaaaccgtaggggtcgatgtgcccagacaggttggggac
tacggcatcgagcgtgtggcaggcgtggatcatctggtgcgtgcggtgcagggcagtgcc
ggggtcgagcacgcactattgctgccttgtagcgcgctgcgcatccatggtctgcacaac
gcgacgaatgcgctggccgcgctggcgctggccgaggcagcgggctgcccgatcggcgcc
gtgcgcgatgccctgtgtgcgtaccggggcgaaccgcatcgcgtggaggccgtggggcag
atcgcagacgtggctttcttcgacgacagcaagggaacgaacgtcggcgccacggtggcc
gccctcgaagggctggggccgcagcggcggctcatcgtgctgctgggtggcgatggaaaa
gggcaggatttcgcccccctggcggaacccgttgcgcggtatgcacgtgcggcgatcgtc
tacggacgggacggcgcgtggatccattccgccctgggagacagtgctccggtgtacgaa
gccaccagcttgcagcaagccgtcgatattgccggtggggtggcccaggcgggggatgcc
gtgctgctctcccccgcatgtgcgagctttgacatgtttgacgactatgaacaccgggcg
cgggtgtttcgggatgctgtgcgcgaatgggccgacaagacaggtcaccccttgcaggag
ctgcaaccatga

DBGET integrated database retrieval system