KEGG   Candidatus Symbiobacter mobilis: Cenrod_2559Help
Entry
Cenrod_2559       CDS       T02877                                 

Gene name
gltX
Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
cbx  Candidatus Symbiobacter mobilis
Pathway
cbx00860  Porphyrin and chlorophyll metabolism
cbx00970  Aminoacyl-tRNA biosynthesis
cbx01100  Metabolic pathways
cbx01110  Biosynthesis of secondary metabolites
cbx01120  Microbial metabolism in diverse environments
Module
cbx_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cbx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cenrod_2559 (gltX)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cenrod_2559 (gltX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cbx01007]
    Cenrod_2559 (gltX)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cbx03016]
    Cenrod_2559 (gltX)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:cbx02048]
    Cenrod_2559 (gltX)
Enzymes [BR:cbx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     Cenrod_2559 (gltX)
Amino acid related enzymes [BR:cbx01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Cenrod_2559 (gltX)
Transfer RNA biogenesis [BR:cbx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Cenrod_2559 (gltX)
 Prokaryotic type
   Other AARSs
    Cenrod_2559 (gltX)
Prokaryotic defense system [BR:cbx02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Cenrod_2559 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AGX88613
UniProt: U5NEG1
Position
2809926..2811329
Genome map
AA seq 467 aa AA seqDB search
MTIRTRFAPSPTGFIHLGNIRSALYPWAFARSQGGVFILRIEDTDVQRSTQEAVDVILDG
MRWLGLDYDEGPYYQSQRTQRYREVLAQLCDAGHAYPCYMSQEELDALRERQSAAKCKPR
YDGTWRPEPGKVLPPVPDGGQPVWRFRTPLDGTVVWEDKVKGRIEIANAELDDMVLARSD
GTPTYNFCVVVDDMDMGITHVIRGEDHVNNTPRQIHLFHALGKEPPEYVHLPTVLNEQGD
KMSKRNGAKAVTQYREEGYLADAVVNYLARLGWSHGNDEFFHRAQFLQWFGLDNLGKSPA
QFDEAKLRWVNAQHLKAMGDEALAELVRSQLERRGVEGDERLPRICALFQDRCDTTVALA
DWAMRFYTEVSASAQELATHCTPSIAPALETLAQHLSQCAWDRTAIAAAVREVLAQHGLK
MSQLAMPVRVLVVGTAHTPSLDAVLELVGREKVLARLRNRPQLALEC
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgacgatccgtacccgctttgccccgtcgccgacgggatttatccacctcggcaacatc
cgttccgcgctgtatccgtgggcctttgcgcgttcgcagggcggcgtgttcattctgcgt
atcgaagacaccgacgtgcagcgctccacgcaagaggccgtcgatgtgattttggacggc
atgcgttggctggggttggattacgacgaagggccgtactaccagtcgcagcggacgcag
cggtaccgtgaggtgctcgcgcaattgtgcgatgccgggcatgcctatccctgctacatg
agccaggaagagttggacgccctgcgcgagcgccagagcgcagcgaagtgcaagcctcgc
tacgacggtacgtggcgccccgagcctggcaaggtgctgcccccggttcccgatggcggg
caacccgtatggcgattccgcactccgctggatggcacggtggtgtgggaagacaaggtc
aagggtcgtatcgagattgccaatgccgaacttgacgatatggtgctggcgaggtcagac
ggcacgccgacgtacaacttttgcgtcgtcgtcgacgacatggatatgggcatcacgcac
gtcatccggggggaagaccacgtcaacaacacgccacgacaaatccacctgttccacgcc
ctgggcaaggaaccgccggaatacgtccatctgcccaccgtgctgaacgagcagggcgac
aagatgagcaaacgcaacggcgccaaagcggtgacgcaataccgggaagaaggctacctg
gccgatgccgtcgtcaactacctggcccggctggggtggagccacggcaacgacgagttt
tttcaccgtgcgcagttcttgcagtggtttggtttggacaacctgggcaaaagcccggcg
cagttcgacgaagccaagctgcgctgggtcaatgcccagcatctcaaggccatgggggac
gaggcgctcgcagagctggttcgcagccagctcgaacgccggggcgtggaaggggacgag
cgtttgccacggatctgcgcgttgttccaggatcgctgtgacacgacggtggccttggcg
gattgggcaatgcggttctatacggaagtatcggcatctgcgcaagagctggcaacgcat
tgcaccccgtccattgcgccagcgctggagactttggcccagcatttgtcgcagtgcgcg
tgggatcgcaccgccattgccgcagcagtgcgcgaagtgctggcgcagcatggcctcaag
atgtcccagttggccatgcccgtgcgggtgctcgtggtaggcaccgcgcataccccttcg
ctggatgcggtgctggagttggtggggcgcgaaaaagtgctcgcccggctccggaaccgt
ccccagcttgcactagaatgctga

DBGET integrated database retrieval system