KEGG   Clostridium botulinum A2: CLM_0119Help
Entry
CLM_0119          CDS       T00883                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cby  Clostridium botulinum A2
Pathway
cby00450  Selenocompound metabolism
cby00970  Aminoacyl-tRNA biosynthesis
cby01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cby00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CLM_0119 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CLM_0119 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cby01007]
    CLM_0119 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cby03016]
    CLM_0119 (metG)
Enzymes [BR:cby01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CLM_0119 (metG)
Amino acid related enzymes [BR:cby01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CLM_0119 (metG)
Transfer RNA biogenesis [BR:cby03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CLM_0119 (metG)
 Prokaryotic type
   Other AARSs
    CLM_0119 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f DNA_ligase_ZBD
Motif
Other DBs
NCBI-ProteinID: ACO84163
UniProt: C1FQ35
Position
99267..101204
Genome map
AA seq 645 aa AA seqDB search
MSKGTYYVTTPIYYPSAKLHIGNTYTTVAADTLARFKRLTGYDVMFLTGTDEHGQKIQRL
AEAKKVTPKAYVDEIVAGIKELWKMMNIDYDKFIRTTDEYHVELVQKIFKTLYDKGDIYK
SEYSGWYCTPCESFWTETQLEDGKCPDCGRPVEKAKEEAYFFKMSKYAPKLIEYIESHPE
FIQPESRKNEMLNNFLKPGLQDLCVSRTSFDWGIPVTFDEKHVIYVWIDALANYITALGY
NTEKDELYKKYWPADVHLVGKDILRFHTIYWPIMLMALDIPLPKQVFGHGWLLVDGGKMS
KSKGNVVDPVVLVNHFGTDPVRYYLLREIPFGADGIFNNEIFIKKINSDLANDLGNLLSR
TVAMIEKYFDGEIPAGNCKEDIDEELIKLALETPKKVEENMEKLRIPEALEEIWTFIGRA
NKYIDETTPWILAKDESKKERLGTVLYNLAESLRIISVCISAFIPETSIKINEQINADVL
NWDSLSKFNGTKVGTKVKKGEAIFPRIDVEKKIEELNKLKEEQLKQNKAKNIAPIKEEIT
IDDFEKIDLRVAKVLECEPIKGAKKLLKLKVSLGGEERQVVSGIAKYYKPEDLIGKKVVL
AANLKPVKLRGELSQGMILAASTEDDSELFVASIDGDIEEGNIVR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaggaacttattatgtaacaacacctatatattatccgtcagcgaaacttcat
ataggaaatacttatacaacggttgctgcagatactttagctagatttaaaagacttaca
ggttatgatgtaatgtttttaactggtacagatgaacacggacaaaaaatacaaagatta
gcagaagctaaaaaagttacacctaaggcttatgtagatgaaatagtagcgggaataaaa
gaactatggaagatgatgaatatagactatgataaatttataagaacaacagatgaatat
catgtagaattagtgcaaaaaatatttaaaacattgtatgataaaggtgatatatataaa
agcgagtattcaggatggtattgtacaccttgtgaatcattttggacagaaactcaatta
gaagatggaaagtgcccagattgtggaagacctgtagaaaaagcaaaagaagaagcatat
ttctttaaaatgtcaaaatatgctcctaaacttatagaatatatagaatctcatccagag
tttatacaaccagaatcaagaaaaaatgaaatgctaaataactttttgaaacctggcctt
caagatttatgtgtatctagaacatcttttgattggggaataccagttacttttgatgaa
aaacatgtaatttatgtttggatagatgcacttgctaattatataacagcattaggatat
aatacagaaaaggatgaattatataaaaaatactggccagcagatgtacacttagttggt
aaggatatattaagatttcatactatatattggccaattatgcttatggcattagatata
cctcttccaaagcaggtatttggtcatggatggttattggtagatggggggaaaatgtca
aaatccaaaggtaatgtggtagatccagtagttttagtaaatcattttggaacagatcct
gtaagatactatcttcttcgagaaataccttttggcgcagacggaatatttaataatgag
atttttataaagaaaataaattcagatttagcaaatgatttgggaaatttattatctaga
acagtagctatgatagaaaaatattttgatggagaaataccagcaggaaattgcaaagag
gatatagatgaagagttaataaaattagcccttgaaactccaaaaaaagtggaagaaaat
atggaaaaactaagaataccagaagctttagaagaaatatggacatttataggaagagct
aataagtatatagatgaaacaacaccatggattcttgcaaaagatgagtctaaaaaagag
agattgggtacagttttatataatctagcagaaagtttaagaataatatcagtatgtata
tcagcattcataccagaaacaagtataaaaataaatgaacaaataaatgcggatgtttta
aattgggatagtttaagtaaatttaatggaactaaagtaggcacaaaggttaaaaaagga
gaagcaatattcccaagaatagatgtagaaaagaaaatagaagagctaaataaacttaaa
gaagaacaattaaaacaaaacaaagctaaaaatatagcacctataaaagaagaaataact
atagatgattttgaaaaaatagatttaagggtagctaaggttttagaatgtgaacctata
aaaggagctaaaaaattattaaaactaaaagttagtttaggtggagaagaaagacaggta
gtatcaggaatagctaaatactataaaccagaagacttaataggtaaaaaagtagtatta
gcagctaatttaaagcctgttaagctaagaggagaattgtcacaaggaatgattttagca
gcatcaacagaagatgatagtgagctatttgtagcatcaatagatggagacattgaagaa
ggaaatatagtaaggtaa

DBGET integrated database retrieval system