KEGG   Clostridium botulinum A2: CLM_0217Help
Entry
CLM_0217          CDS       T00883                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cby  Clostridium botulinum A2
Pathway
cby03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cby00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CLM_0217
Enzymes [BR:cby01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CLM_0217
DNA repair and recombination proteins [BR:cby03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CLM_0217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 HHH_5 AAA_11 Viral_helicase1 Helicase_RecD PIF1 HHH HHH_2 DEAD PhoH AAA UvrD_C DUF2075 AAA_22 SRP54 AAA_23 T2SSE NTPase_1 DUF853 AAA_28 RsgA_GTPase DNA_pol_lambd_f HHH_3 AAA_29 AAA_16 AAA_12 AAA_24 Cytidylate_kin ABC_tran ABC_ATPase UvrD-helicase ATP-synt_ab
Motif
Other DBs
NCBI-ProteinID: ACO83762
UniProt: C1FQQ6
Position
196598..198832
Genome map
AA seq 744 aa AA seqDB search
MQEIQGFIEDILFKNDENGYVVAKIRKKKELITIVGCMPYITEGQNLKLKGEWVIHPQFG
NQFKVEVCEEIVPDTVAGIERYLSSGIISGIGPVTAKKIVKKFGEETLNILDSNIERLTE
IEGIGKKKIEVIYDSYIKQNEVRNIMMFFQNYGVTPNQCMKVYKRFGENSISIVKENPYI
LTEEIRGIGFKTADKIARSLGIASNSPFRIQSGINYIINGFCSLGNTYMPLEKLVSEAMD
ILGVREEEIHENIYNNIAENKLKIEKVKEQSCVFTLPYYYCELGVTKKILSLSLSQYDNL
NINIEDEIVSFEKNNNIKFHDSQREAIKGALENGVEIITGGPGTGKTTIINCITEIFEKA
NMKVYMAAPTGRAAKRMSETTGREAKTIHRMLEMGVSEDDTEEVFSKGEETPLECDVVII
DEASMIDIILMNTLLKAIALGTRIIIVGDVDQLPSVGPGNVLRDLIESKCVKVVRLKEIF
RQSKESMIIVNAHRINDGEMPIINKKDKDFYFIECSEPKKIVNTLLELSNRRLPKFNKSW
HKIHDIQILSPMRKGVLGVSSLNKELQSVLNPKNDSKKEMEFKDYIFRVGDKVMQTKNNY
SLKWTRASGEGEAEGLGIFNGDVGYIEDIDEEKETIQVLFDNERRVIYENLYLDEIDLAY
AVTIHKSQGSEFPVVIMPAFKGPPLLMNRNLLYTGITRAKRLVVLVGSLKSINFMVQNDK
IFERYSLLKWRISNILDTEIINGE
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaatacagggatttatagaggatatactttttaaaaatgatgaaaatgggtat
gtagtggcaaaaataaggaagaagaaagagcttataaccatagtcggatgtatgccctac
ataacagaaggacaaaacttaaaattaaaaggtgaatgggtaattcatccacaatttggt
aatcaattcaaagtagaagtatgtgaagaaatagtacccgatactgtagctggtatagaa
agatatttatcctcaggaatcatatcaggtataggcccagtgactgcaaaaaaaattgtg
aaaaaatttggagaagaaacattaaatatattagacagtaatatagaaagattaacagag
atagagggaataggaaagaagaagatagaggtaatatatgattcctatataaaacaaaat
gaagtgcgaaatataatgatgttttttcaaaattacggagttacacctaaccaatgcatg
aaagtttataaaagatttggagaaaattctatatcaatagttaaagagaatccatatata
cttacggaagaaataagaggaataggtttcaagacagcagataaaatagctaggagctta
ggaatagcctctaattcaccttttagaattcagagtggaataaattatataataaatgga
ttctgtagtttagggaatacttatatgcctttagagaagcttgtaagtgaggctatggac
atattaggggtaagagaagaagaaatacatgaaaatatatataataatatagcagaaaat
aaattaaagatagaaaaagtaaaagaacaaagttgtgtttttactctaccgtattattat
tgcgaattaggagttacaaaaaaaatacttagcttatctttgtcacaatatgataattta
aatataaatatagaagacgagatagtgagttttgaaaaaaataataatataaaatttcat
gattctcaaagagaggctataaaaggtgccttagaaaatggagtagaaataataacagga
ggccctggtacaggaaaaacaactattatcaattgtataacagagatatttgaaaaagct
aatatgaaagtttatatggcagcacctacaggaagagcggctaaaagaatgtctgaaact
acaggtagagaagctaaaacaatacataggatgttagaaatgggtgtatctgaggatgac
acagaagaagttttttctaaaggtgaagaaactcctttagaatgtgatgtagtaataata
gatgaagcctccatgatagatataatattaatgaatacactgttaaaggccatagcttta
ggtacaagaataataatagttggggatgtagatcaacttccctcagtaggtccagggaat
gtattaagagatttaatagaaagtaagtgtgtaaaggtagttagattaaaggagatattc
agacaatctaaagaaagtatgattatagtaaatgcccatagaataaatgatggagagatg
ccaattataaataaaaaagataaagatttttattttatagaatgtagtgaacctaaaaaa
atagttaatacattattagaactttcaaatagaagattgcctaaatttaataaaagttgg
cataaaattcatgatatacaaatactatctccaatgagaaagggagttctaggagtttct
agtttaaataaggaattacaatctgttttaaaccctaaaaatgattcaaaaaaagaaatg
gaatttaaggattatatatttagagtaggagataaagttatgcaaaccaaaaataactac
tctttaaagtggaccagagcaagtggtgagggggaagcagaagggttaggaatatttaat
ggagatgtaggatatatagaggatatagatgaggaaaaagaaacaattcaggtcttattt
gataatgaaagaagagtaatatatgaaaatttatatttagatgaaatagatttagcttat
gctgtaactattcataaaagtcaaggtagcgaatttccagtagtaattatgccagctttt
aaaggtcccccacttttaatgaatagaaatttattgtatacaggaataacaagagcaaaa
aggcttgttgtcttggtaggatctttaaaatctattaattttatggtacagaatgataaa
atttttgaaagatactctcttttaaagtggcgtataagtaatattttagatactgaaatt
ataaatggagaataa

DBGET integrated database retrieval system