KEGG   Clostridium botulinum A2: CLM_0897Help
Entry
CLM_0897          CDS       T00883                                 

Gene name
botA
Definition
(GenBank) bontoxilysin A
  KO
K06011  botulinum neurotoxin [EC:3.4.24.69]
Organism
cby  Clostridium botulinum A2
Brite
KEGG Orthology (KO) [BR:cby00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cby01002]
    CLM_0897 (botA)
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:cby02042]
    CLM_0897 (botA)
Enzymes [BR:cby01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.69  bontoxilysin
     CLM_0897 (botA)
Peptidases and inhibitors [BR:cby01002]
 Metallo peptidases
  Family M27
   CLM_0897 (botA)
Bacterial toxins [BR:cby02042]
 Type III toxins: Intracellular toxins
  Metalloprotease
   Botulinum neurotoxin (BoNT)
    CLM_0897 (botA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M27 Toxin_trans Toxin_R_bind_C Toxin_R_bind_N Laminin_G_3 Peptidase_M91 H2TH
Motif
Other DBs
NCBI-ProteinID: ACO83782
UniProt: Q45894
Structure
PDB: 

Position
956218..960108
Genome map
AA seq 1296 aa AA seqDB search
MPFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLN
PPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGG
STIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHDVLNLTRNGY
GSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAEHRLYGIAINPN
RVFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDVASTLNKA
KSIIGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVNFFKV
INRKTYLNFDKAVFRINIVPDENYTIKDGFNLKGANLSTNFNGQNTEINSRNFTRLKNFT
GLFEFYKLLCVRGIIPFKTKSLDEGYNKALNDLCIKVNNWDLFFSPSEDNFTNDLDKVEE
ITADTNIEAAEENISLDLIQQYYLTFDFDNEPENISIENLSSDIIGQLEPMPNIERFPNG
KKYELDKYTMFHYLRAQEFEHGDSRIILTNSAEEALLKPNVAYTFFSSKYVKKINKAVEA
FMFLNWAEELVYDFTDETNEVTTMDKIADITIIVPYIGPALNIGNMLSKGEFVEAIIFTG
VVAMLEFIPEYALPVFGTFAIVSYIANKVLTVQTINNALSKRNEKWDEVYKYTVTNWLAK
VNTQIDLIREKMKKALENQAEATKAIINYQYNQYTEEEKNNINFNIDDLSSKLNESINSA
MININKFLDQCSVSYLMNSMIPYAVKRLKDFDASVRDVLLKYIYDNRGTLVLQVDRLKDE
VNNTLSADIPFQLSKYVDNKKLLSTFTEYIKNIVNTSILSIVYKKDDLIDLSRYGAKINI
GDRVYYDSIDKNQIKLINLESSTIEVILKNAIVYNSMYENFSTSFWIKIPKYFSKINLNN
EYTIINCIENNSGWKVSLNYGEIIWTLQDNKQNIQRVVFKYSQMVNISDYINRWIFVTIT
NNRLTKSKIYINGRLIDQKPISNLGNIHASNKIMFKLDGCRDPRRYIMIKYFNLFDKELN
EKEIKDLYDSQSNSGILKDFWGNYLQYDKPYYMLNLFDPNKYVDVNNIGIRGYMYLKGPR
GSVVTTNIYLNSTLYEGTKFIIKKYASGNEDNIVRNNDRVYINVVVKNKEYRLATNASQA
GVEKILSALEIPDVGNLSQVVVMKSKDDQGIRNKCKMNLQDNNGNDIGFIGFHLYDNIAK
LVASNWYNRQVGKASRTFGCSWEFIPVDDGWGESSL
NT seq 3891 nt NT seq  +upstreamnt  +downstreamnt
atgccatttgttaataaacaatttaattataaagatcctgtaaatggtgttgatattgct
tatataaaaattccaaatgcaggacaaatgcaaccagtaaaagcttttaaaattcataat
aaaatatgggttattccagaaagagatacctttacaaaccctgaagaaggagatttaaat
ccaccaccagaagcaaaacaagttccagtttcatattatgattcaacatatttaagtaca
gataatgaaaaagataattatttaaagggagttacaaaattatttgagagaatttattca
actgatcttggaagaatgttgttaacatcaatagtaaggggaataccattttggggtgga
agtacaatagatacagaattaaaagttattgatactaattgtattaatgtgatacagcca
gatggtagttatagatcagaagagcttaatctagtaataataggaccctcagctgatatt
atacagtttgaatgtaaaagctttggacatgatgttttgaatcttacgcgaaatggttat
ggctctactcaatacattagatttagcccagattttacatttggttttgaggagtcactt
gaagttgatacaaatcctcttttaggtgcaggcaaatttgctacagatccagcagtaaca
ttagcacatgaacttatacatgccgaacatagattatatggaatagcaattaatccaaat
agggtttttaaagtaaatactaatgcctattatgaaatgagtgggttagaagtaagcttt
gaggaacttagaacatttgggggacatgatgcaaagtttatagatagtttacaggaaaac
gaatttcgtctatattattataataagtttaaagatgtagcaagtacacttaataaagct
aaatcaataataggtactactgcttcattacagtatatgaaaaatgtttttaaagagaaa
tatctcctatctgaagatacatctggaaaattttcggtagataaattaaaatttgataag
ttatacaaaatgttaacagagatttacacagaggataattttgttaatttttttaaagta
attaacagaaaaacatatttgaattttgataaagccgtatttagaataaatatagtacct
gatgaaaattacacaataaaggatggatttaatttaaaaggtgcaaatttatcaacaaat
tttaatggtcagaatacagaaattaatagtaggaattttactagattaaaaaattttaca
ggattatttgaattttataagctgctatgtgtaagagggataataccttttaaaactaaa
tcattagatgaaggatacaataaggcattaaatgatttatgtatcaaagttaataattgg
gacttgttttttagtccttcagaagataattttactaatgatttagataaagtagaagaa
attacagctgataccaatatagaagcagcagaagaaaatattagtttagatttaatacaa
caatattatttaacttttgattttgataatgaacctgaaaatatttcaatagaaaatctt
tcaagtgatattataggccaattagagcctatgcctaatatagaaagatttcctaatgga
aaaaagtatgagttagataaatatactatgttccattatcttcgtgctcaagaatttgaa
catggtgattctagaattatcttaacaaattctgctgaagaagcattattaaagcctaat
gttgcttatacatttttttcttcaaaatatgtaaagaagattaataaagccgtagaggca
tttatgtttttaaattgggcagaagagttagtatatgactttaccgatgaaactaatgaa
gtaactactatggataaaattgctgatataactataattgttccatatatagggcctgct
ttaaatataggtaatatgttatctaaaggagagtttgtagaagctataatatttacggga
gttgttgctatgttagaatttataccagagtatgctctccctgtatttggtacttttgca
attgtatcatatattgccaataaggttctaactgttcaaacaataaataatgctttaagt
aaaagaaatgaaaaatgggatgaagtctataaatatacagtaacaaattggctagcaaag
gttaatacacagattgatctaataagggaaaaaatgaaaaaagctttagaaaatcaggca
gaagcaacaaaggctataataaactatcagtataatcaatatactgaggaagagaaaaat
aatattaattttaatattgatgatttaagttcgaaacttaatgagtctataaatagcgct
atgattaacataaataaatttttggatcaatgctctgtttcatatttaatgaattctatg
ataccttatgctgttaaacggttaaaagattttgatgctagtgttagagatgtattatta
aagtatatatatgataatagaggaactttagttcttcaagtagatagattaaaagatgaa
gttaataatacacttagtgcagatataccttttcagctttccaaatacgtagataataaa
aaattattatctacatttactgaatatattaagaatattgttaatacctctatattgagt
atagtatataaaaaagatgatttaatagatttatctaggtatggagcaaaaataaatatt
ggcgatagagtatattatgattcaatagataaaaatcaaattaaattaattaatttagaa
agtagtacaattgaggtaattttaaaaaatgctattgtatataatagtatgtatgaaaat
tttagtactagcttttggataaaaattcctaagtattttagcaagataaatctaaataat
gaatatacaataataaattgtatagaaaataattcaggatggaaagtatcacttaattat
ggtgaaataatctggactttgcaggataataagcaaaacatacaaagagtagtttttaaa
tacagtcaaatggttaatatatcagattatataaacagatggatttttgtaactatcact
aataatagactaactaaatctaaaatttatataaatggaagattaatagatcaaaaacca
atttcaaatttaggtaatattcatgctagtaataagataatgtttaaattagatggctgt
agagatccacgtagatacatcatgataaaatatttcaatcttttcgataaagaattaaat
gaaaaagaaatcaaagatttatatgatagtcaatcaaattcaggtattttaaaagacttt
tggggtaattatttacaatatgataaaccatactatatgttaaatttatttgatccaaat
aaatatgtcgatgtaaataatataggtattagaggttatatgtatcttaaagggcctaga
ggtagcgtagtgactacaaacatttatttaaattcaactttgtatgaggggacaaaattt
attataaaaaaatatgcttctggaaatgaagataatattgttagaaataatgatcgtgta
tatattaatgtagtagttaaaaataaagaatataggttagctactaatgcatcacaggca
ggcgtagaaaaaatactaagtgcattagaaatacctgatgtaggaaatctaagtcaagta
gtagtaatgaagtcaaaagatgatcaaggaataagaaataaatgcaaaatgaatttacaa
gataataatgggaatgatataggctttataggatttcatttgtatgataatatagctaaa
ctagtagcaagtaattggtataatagacaagtgggaaaagctagtaggactttcggttgt
tcatgggagtttattcctgtagatgatggatggggagaaagttcactgtaa

DBGET integrated database retrieval system