KEGG   Clostridium botulinum A2: CLM_1446
Entry
CLM_1446          CDS       T00883                                 

Definition
(GenBank) xanthine dehydrogenase family protein, iron-sulfur binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
cby  Clostridium botulinum A2
Pathway
cby00230  Purine metabolism
cby01100  Metabolic pathways
cby01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cby00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLM_1446
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 Fer2_4
Other DBs
NCBI-ProteinID: ACO85084
UniProt: C1FL12
Position
1497860..1498333
AA seq 157 aa
MSLKRKIKFTVNDKKYEVEIDIRESLSEVLRSRLHLTGVKQGCLVGECGACTVLIDGVPT
DSCIYLAAWADGKTIKTIEGVQKNGELSEIQKAFIDEGAVQCGFCTPGLVLTTTALVESE
KNYTDDEIKREISGHLCRCTGYNKIFNATKKAILKRK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgagtttaaaaagaaaaataaaatttacagttaatgataaaaagtatgaagtagaaata
gatattagagaatctttatcagaagtgttaagaagtagattacatttaacaggtgttaaa
caaggatgtcttgtaggagaatgtggagcatgtactgtcttaatagatggtgtcccaaca
gactcatgtatttacttagcggcttgggctgatggtaaaacaataaaaactattgagggg
gtacaaaaaaatggtgagctttcagagattcaaaaagcctttatagatgaaggtgctgta
caatgtggattctgtacaccgggtttagttttaactacaacagctttagtagaaagcgaa
aaaaactatactgatgatgaaataaaaagagaaatatcaggtcatttatgcagatgtact
ggatataataaaatatttaatgctaccaaaaaagctattttaaaaagaaaataa

DBGET integrated database retrieval system