KEGG   Clostridium botulinum A2: CLM_1815Help
Entry
CLM_1815          CDS       T00883                                 

Gene name
hisE
Definition
(GenBank) phosphoribosyl-ATP pyrophosphohydrolase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
cby  Clostridium botulinum A2
Pathway
cby00340  Histidine metabolism
cby01100  Metabolic pathways
cby01110  Biosynthesis of secondary metabolites
cby01230  Biosynthesis of amino acids
Module
cby_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cby00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    CLM_1815 (hisE)
Enzymes [BR:cby01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     CLM_1815 (hisE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: ACO85120
UniProt: C1FN44
Position
1845687..1846019
Genome map
AA seq 110 aa AA seqDB search
MNKNNVIDSLFNIIEDRKDKPIEGSYTGYLFEKGLDKILKKVGEESSEVIIAAKNEDEEE
LIKEICDLTYHIMVLMVEKQIKLDGIEKELEKRREKICNKKNERKTIEKL
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaataatgttatagatagtttatttaatataatagaggacagaaaagataag
cctatagaaggttcttatactggatatttatttgaaaaaggattggataaaatattaaaa
aaggttggagaagaaagttcagaggtaattatagctgctaaaaatgaagacgaagaggaa
ctgataaaagaaatatgtgatttaacctatcacataatggttttaatggtagaaaaacaa
ataaaattagatggtatagaaaaagaattagaaaagagaagagaaaaaatatgcaataaa
aaaaatgaaagaaaaacaatagagaaattataa

DBGET integrated database retrieval system