KEGG   Clostridium botulinum A2: CLM_1845Help
Entry
CLM_1845          CDS       T00883                                 

Definition
(GenBank) putative glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cby  Clostridium botulinum A2
Pathway
cby00010  Glycolysis / Gluconeogenesis
cby00052  Galactose metabolism
cby00500  Starch and sucrose metabolism
cby00520  Amino sugar and nucleotide sugar metabolism
cby00521  Streptomycin biosynthesis
cby01100  Metabolic pathways
cby01110  Biosynthesis of secondary metabolites
cby01120  Microbial metabolism in diverse environments
cby01130  Biosynthesis of antibiotics
cby01200  Carbon metabolism
Module
cby_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cby_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cby00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLM_1845
   00052 Galactose metabolism
    CLM_1845
   00500 Starch and sucrose metabolism
    CLM_1845
   00520 Amino sugar and nucleotide sugar metabolism
    CLM_1845
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CLM_1845
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CLM_1845
Enzymes [BR:cby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CLM_1845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase FGGY_N IF2_N DUF460
Motif
Other DBs
NCBI-ProteinID: ACO83815
UniProt: C1FN71
Position
1879091..1880038
Genome map
AA seq 315 aa AA seqDB search
MNKKYVVGVDLGGTKIYTALVDLDGNIIKEKNVKTEASKGELDVLYKIINTIDNVIEGVN
LEEIKAIGIGSPGPLDAKEGIIISSSNLPFENFSLVQPIKDKYNIPTYLDNDANVATLAE
FMFGKGKGTQNMIYVTASTGIGAGAIINSRIYRGNTGNALEIGHTTVMKDGPNCGCGNKG
CAESLGSGTAIMKKAKEVCKNNGETSLKKYDNLTAKEVFEEAKKGDKLSKEVLEFCLSYL
GITVANIINTFDPEMVVIGGGVINGGEIVCDIINREVKNRCWKAIRDNCKITKAKLAGKA
GVLGAAALAITESKN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaatatgtagtgggtgttgatttagggggaacaaagatttatacagcactt
gtggatttagatggaaatataataaaagaaaaaaatgttaaaactgaagcaagcaaagga
gaacttgatgtattatataaaataataaatactattgataatgttatagaaggagtaaac
ttagaggaaataaaggctataggaataggttcaccaggacctttagatgctaaagaaggt
ataataatttcatcttcaaatctaccctttgaaaattttagcttagttcaacctataaag
gataaatataatattccaacatacctagacaatgatgctaatgtagctactttagctgaa
tttatgtttggtaaaggaaaaggtacccagaacatgatatacgtaacagcaagtacaggc
attggagcaggagctataataaatagcagaatatatagaggaaatacaggaaatgcttta
gaaataggtcatacaactgttatgaaggatggaccgaactgtggttgtggtaataagggt
tgcgcagaaagtttaggttctggtactgccattatgaaaaaggcaaaagaagtttgtaaa
aataatggagagacatctttaaaaaaatatgataatctaactgcaaaggaagtttttgaa
gaagctaaaaaaggagataagctttcaaaggaagtgctagaattttgcttatcctattta
ggtataactgtagccaatataataaatacttttgatccagaaatggttgttataggcgga
ggagttataaatggtggagaaattgtttgtgatataataaatagagaagtgaaaaataga
tgctggaaagctattagagataattgtaaaataacaaaagcaaagcttgcaggaaaagca
ggggttctaggagctgcagccttagctataactgaaagtaaaaattaa

DBGET integrated database retrieval system