KEGG   Clostridium botulinum A2: CLM_3612Help
Entry
CLM_3612          CDS       T00883                                 

Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cby  Clostridium botulinum A2
Pathway
cby00071  Fatty acid degradation
cby00280  Valine, leucine and isoleucine degradation
cby00310  Lysine degradation
cby00362  Benzoate degradation
cby00380  Tryptophan metabolism
cby00620  Pyruvate metabolism
cby00630  Glyoxylate and dicarboxylate metabolism
cby00640  Propanoate metabolism
cby00650  Butanoate metabolism
cby00900  Terpenoid backbone biosynthesis
cby01100  Metabolic pathways
cby01110  Biosynthesis of secondary metabolites
cby01120  Microbial metabolism in diverse environments
cby01130  Biosynthesis of antibiotics
cby01200  Carbon metabolism
cby01212  Fatty acid metabolism
cby02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLM_3612
   00630 Glyoxylate and dicarboxylate metabolism
    CLM_3612
   00640 Propanoate metabolism
    CLM_3612
   00650 Butanoate metabolism
    CLM_3612
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CLM_3612
   00072 Synthesis and degradation of ketone bodies
    CLM_3612
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLM_3612
   00310 Lysine degradation
    CLM_3612
   00380 Tryptophan metabolism
    CLM_3612
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLM_3612
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CLM_3612
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CLM_3612
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cby04147]
    CLM_3612
Enzymes [BR:cby01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CLM_3612
Exosome [BR:cby04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLM_3612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACO84750
UniProt: C1FL75
Position
complement(3650793..3651971)
Genome map
AA seq 392 aa AA seqDB search
MKNVVIASAVRTPIGKFGGTLKSVSAIELGSIVIKEALKRANVKPEDVDEVIMGNVLQAG
LGQNSTRQSAVAAGIPVEVPSFTINKVCGSGLRAVSLATQLIKLGDDDIVVAGGTENMSA
APYLLEKARWGQRMGDGKIVDEMIRDGLWESFNDYHMGITAENIAEQWGITREEQDEFSA
KSQQKAEKAVKEGRFKEEIVPVVIKSRKGEVVFDTDEFPRFGATKESLSKLKPAFKKDGT
VTAGNASGINDGAAALVIMSEEKANELGIKPLAKIVAYGTSGVDPKIMGYGPFYATKKTL
EKANLKIADMDLIEANEAFAAQSLAVAKDLGFDMDKVNVNGGAIALGHPIGCSGARILTT
LLYEMEKRNSKHGLATLCIGGGMGTAIIVERY
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgttgttattgctagtgctgtaagaacacctataggaaaatttggaggaaca
ttaaaaagtgtttcagctatagaattaggaagtattgttattaaagaagctttaaaaaga
gctaatgtaaaaccagaagatgttgatgaggttataatgggtaatgtacttcaagcaggt
cttggtcaaaactcaacaagacaatctgcagtagcggcaggtataccagtagaagtacca
agctttacaataaataaggtttgtggttcaggacttagagcagtaagtttagcaactcaa
ttaataaaactcggagatgacgatatagtagtagcaggtggtacagaaaatatgtctgca
gctccatatcttttagaaaaagcaagatggggacagagaatgggcgatggaaaaattgta
gacgagatgataagagatggactatgggaatcttttaatgactatcatatggggattacg
gctgaaaatatagcagagcaatggggaataacaagagaagagcaagacgaattttcagct
aaatcacaacaaaaagcagagaaagctgtaaaagaaggaagatttaaagaggaaatagta
ccagtagttattaaaagtagaaaaggcgaagtagtatttgatactgatgaatttcctaga
tttggtgctactaaagagagcctttctaaattaaaaccagctttcaaaaaagatggaaca
gttacagctggtaatgcttcaggtataaatgatggagcagctgctttagttatcatgagt
gaagaaaaggcaaatgaattaggaattaaacctttagctaaaatagttgcttatggtaca
agtggagtagatccaaagataatggggtatggaccattttatgcaactaaaaaaacttta
gaaaaagccaacctaaaaatagcagatatggatttaatagaagcaaatgaagcttttgcg
gctcaaagtttagcagtagctaaagatctaggttttgatatggataaagtaaatgtaaat
ggtggagctatagctttaggacatccaattggatgctcaggggctagaatattaactact
ttattatatgaaatggaaaaaagaaactcaaaacatggcttagctaccttatgtataggc
ggtggaatgggaacagctattattgttgaaagatattaa

DBGET integrated database retrieval system