KEGG   Clostridium botulinum A2: CLM_3788Help
Entry
CLM_3788          CDS       T00883                                 

Definition
(GenBank) putative dipeptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cby  Clostridium botulinum A2
Pathway
cby00300  Lysine biosynthesis
cby01100  Metabolic pathways
cby01120  Microbial metabolism in diverse environments
cby01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cby00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CLM_3788
Enzymes [BR:cby01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CLM_3788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 SL4P
Motif
Other DBs
NCBI-ProteinID: ACO85847
UniProt: C1FM09
Position
complement(3826084..3827475)
Genome map
AA seq 463 aa AA seqDB search
MEINKIIEELKDDLIDSTAELVKIKSIEDEAKEGKPYGEGVASALEKALEISEKLGFKTV
NVDGYVGYAEYGEGDEYVGVLGHLDLVPEGDGWKYPPYGAEIHDGKMYGRGTTDDKGPIM
AALYGLKAIKESKLPLSKKVRILFGTNEETGSKEIEHYLEKEKPPVLGFTPDAEYPIIYA
EKGITIFDIVKKLEIKSSKAIKLKYIKGGEASNMVPDYCEAGIECPDTDMIIRSLEYCAN
RNGIELTAEEKDGLVVIKSFGLSAHGSTPEIGKNAIMQMFKFLAELPLGHCDELQFIRFF
NNNVGNETDGKTFGVELEDEPSGKLSFNVGTISMENNEIRMSLNLRYPVTYKSEDLMEKF
NKKIDGTGIKVENFEDQKPLYFDAEHQLIKSLQKVYKEQTGKEPELLAIGGGTYAKEMPN
MVAFGPLFPGEPDVIHKKDEYIELENLVLNAKIYGHAIYELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
ttggagataaataaaataatagaagagctaaaagatgatcttatagactctactgcagaa
ttagttaaaattaagagtatagaagatgaagcaaaggaaggtaaaccttatggggaaggc
gtagccagtgctttggaaaaagcattagaaataagtgaaaagctaggttttaaaactgta
aacgtagatggatatgttggatatgctgaatacggtgaaggtgatgaatatgtaggtgtt
ttaggtcatttggatttagtaccagaaggagatggatggaagtatccaccttatggagca
gaaatacatgatggaaaaatgtatggtagaggaactacagatgacaaggggcctataatg
gcagcactttacggtttaaaagccataaaagaatcaaaacttcctttatctaaaaaggtt
agaatcttgtttggaacaaatgaagaaacaggttctaaagaaatagaacattatttagaa
aaggaaaaaccaccagtacttggatttactccagatgctgagtatccaataatctatgct
gaaaaaggaattacaatatttgatatagtaaaaaaattagaaataaaaagtagcaaagct
attaaattaaaatatattaaaggtggagaagcatctaatatggtgccagattattgtgaa
gctggtatagaatgtccagatacagatatgataataagatctttagagtattgtgctaat
agaaatgggatagaattaacagcagaagaaaaagatggtttagtagtaattaaatctttt
ggactatccgctcatggaagtacaccagagattggtaagaatgctataatgcaaatgttt
aaatttttagcagaacttccattaggtcattgtgatgaattacaattcataagatttttt
aataataatgtaggaaatgaaactgatggtaaaacttttggtgtagagctagaagatgaa
ccatcaggtaagttaagttttaatgtaggaactatttctatggaaaataatgaaataaga
atgtcattaaatttaagatatcctgtaacatataaatcagaagatcttatggaaaagttc
aataaaaagatagatggaacaggaataaaggtagaaaattttgaggatcaaaaaccttta
tattttgatgcagaacaccaattaataaaatcattacaaaaagtatataaagaacaaaca
ggaaaagaaccagaattactagctataggtggaggaacttatgcaaaagaaatgcctaat
atggttgcctttggaccacttttccctggagaaccagatgtaattcataaaaaagatgaa
tatatagaactagaaaatttggtgttaaatgcaaaaatatacgggcatgctatatatgaa
ttagccaaatag

DBGET integrated database retrieval system