KEGG   Clostridium beijerinckii ATCC 35702: Cbs_0055Help
Entry
Cbs_0055          CDS       T03415                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cbz  Clostridium beijerinckii ATCC 35702
Pathway
cbz00450  Selenocompound metabolism
cbz00970  Aminoacyl-tRNA biosynthesis
cbz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Cbs_0055
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cbs_0055
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cbz01007]
    Cbs_0055
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cbz03016]
    Cbs_0055
Enzymes [BR:cbz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Cbs_0055
Amino acid related enzymes [BR:cbz01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Cbs_0055
Transfer RNA biogenesis [BR:cbz03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Cbs_0055
 Prokaryotic type
   Other AARSs
    Cbs_0055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f DALR_1 DALR_2 DNA_ligase_ZBD zf-Mss51 DUF1272
Motif
Other DBs
NCBI-ProteinID: AIU01530
Position
72579..74516
Genome map
AA seq 645 aa AA seqDB search
MCADCKKTYYITTPIYYPSTKLHIGNTYTTVAADALARFKRLTGYDVMFLTGTDEHGQKI
QRIAEEKGITPKQHVDEVVAGIKDLWSMMNISYDKFIRTTDDYHIKAVQDIFKKLYDQGD
IYKSSYEGWYCTPCESFWTDTQLVNGNCPDCGRPVEKSKEEAYFFKMSKYADKLIKYIED
HPEFIQPESRKNEMLNNFLRPGLQDLCVSRTSFNWGVPVTFDESHVVYVWIDALSNYITA
LGYGQENKDLYNKYWPADVHLIGKDILRFHTIYWPIMLMALDLPLPKQVFGHGWLLVDGG
KMSKSKGNVVDPVVLVNEFGVDPVRYYLLKEIPFGADGLFNNEIFIKKINSDLCNDLGNL
LSRTVAMVEKYFGGEMPAQDEKEAIDDELINLALSAPAKIEEAINELNIPQALEYVFELI
RRANKYIDETTPWILAKDESKKARLGTVLYNLAESLRFASVMISAFLPETSKKINEQINT
TEISWESLKSFDGIKAGTKVVKADNLFPRIDVDKKLEELEALKAAQTPAKREITPIKEEI
TIDDFEKVDLRVVKVLACEPIKGAKKLLKLKVDLGGEERQVVSGISKFYKPEEIVGKNVV
LVANLKPVKLRGELSQGMILCAATDDDSILKAVDPGEIPTGSIVR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgcagattgtaaaaaaacatattatattacgacaccaatttattatccatcaaca
aagcttcatataggtaatacctatacaactgtagctgctgatgctttagcaagatttaag
agattaacaggctatgatgtaatgttcttaacaggaacagatgaacatggtcaaaagatc
caaagaatagctgaagaaaagggaatcacaccaaaacaacatgtagatgaagttgttgct
ggtattaaagatctttggagcatgatgaatataagttatgataagttcattagaactact
gatgattatcatattaaagctgttcaagatatatttaagaaattatatgatcaaggagat
atatataagagttcttatgaaggttggtattgcacaccttgtgaatctttctggactgat
acacaattagtaaatggaaattgccctgattgcggaagaccagttgaaaaatcaaaggag
gaagcatatttcttcaagatgagcaagtatgctgataagttaatcaaatatattgaagac
catccagagttcattcaaccagaatcaagaaaaaatgaaatgctaaataatttcttaaga
ccaggtcttcaagatctttgtgtttcaagaacaagctttaactggggagtacctgtaact
tttgatgaaagtcatgttgtatatgtttggattgatgcattatcaaactatattactgcc
cttggatatggtcaagaaaataaagatttatataataaatactggccagcagatgtacat
ctaataggaaaagatattttaagattccatactatttattggccaataatgttaatggcg
ctagatctacctcttccaaagcaagttttcggtcatggatggctacttgttgatggtggg
aaaatgtcaaaatctaaaggtaatgtagtagatccagttgttcttgtaaatgaatttgga
gttgatcctgtaagatattatttattaaaagaaattccatttggagcagatggattattt
aataatgaaatatttataaagaaaataaattcagacctttgtaatgatttaggtaatctt
ttatcaagaacagttgcaatggttgaaaaatattttggtggagaaatgccagctcaagat
gaaaaagaagctattgatgatgaattaataaatttagcattatcagcaccagctaaaatt
gaggaggcaataaacgaattaaatatacctcaagctttagaatatgtttttgaattaata
agaagagcaaacaaatatatagatgaaacaactccatggatattagctaaagatgaaagt
aaaaaggctagacttggaacagttctttataatttagccgaaagcttaagatttgcatca
gtaatgatttcagcattcttgccagaaacatctaagaagattaatgagcaaattaatact
acagaaatttcatgggaatcattaaagtcatttgatggaattaaggcaggaactaaggta
gtaaaggctgacaacttattcccaagaatagatgtagataagaaattagaagaattagaa
gctttaaaggctgctcaaacaccagctaagagagaaattacacctataaaagaagaaata
acaatagatgattttgaaaaggttgatttaagagtagtaaaagtattagcatgtgaacca
ataaagggagctaagaaactattaaaattaaaagttgatttaggtggagaagaaagacaa
gtggtttctggaatatctaagttctataaaccagaagaaatagtaggtaaaaatgtagtt
ttagttgctaacttaaagccagtaaaacttagaggcgaattatcacaaggaatgatttta
tgtgctgcaacagatgatgacagtatattaaaagcagtggatccaggtgagattccaaca
ggtagcattgtaagataa

DBGET integrated database retrieval system