KEGG   Clostridium beijerinckii ATCC 35702: Cbs_0411Help
Entry
Cbs_0411          CDS       T03415                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbz  Clostridium beijerinckii ATCC 35702
Pathway
cbz00071  Fatty acid degradation
cbz00072  Synthesis and degradation of ketone bodies
cbz00280  Valine, leucine and isoleucine degradation
cbz00310  Lysine degradation
cbz00362  Benzoate degradation
cbz00380  Tryptophan metabolism
cbz00620  Pyruvate metabolism
cbz00630  Glyoxylate and dicarboxylate metabolism
cbz00640  Propanoate metabolism
cbz00650  Butanoate metabolism
cbz00900  Terpenoid backbone biosynthesis
cbz01100  Metabolic pathways
cbz01110  Biosynthesis of secondary metabolites
cbz01120  Microbial metabolism in diverse environments
cbz01130  Biosynthesis of antibiotics
cbz01200  Carbon metabolism
cbz01212  Fatty acid metabolism
cbz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cbs_0411
   00630 Glyoxylate and dicarboxylate metabolism
    Cbs_0411
   00640 Propanoate metabolism
    Cbs_0411
   00650 Butanoate metabolism
    Cbs_0411
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Cbs_0411
   00072 Synthesis and degradation of ketone bodies
    Cbs_0411
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cbs_0411
   00310 Lysine degradation
    Cbs_0411
   00380 Tryptophan metabolism
    Cbs_0411
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cbs_0411
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cbs_0411
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Cbs_0411
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbz04147]
    Cbs_0411
Enzymes [BR:cbz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Cbs_0411
Exosome [BR:cbz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cbs_0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIU00622
Position
499121..500302
Genome map
AA seq 393 aa AA seqDB search
MREVVIVSAVRTALGSFGGALKDVSAVDLGALVIKEAVNRAGVKPELIEEVIMGNVIQAG
LGQNTARQSTIKAGLPQEVSAMTINKVCGSGLRAVSLAAQMIKAGDADVVVAGGMENMSA
APYALDKARWGQRMGDGKLVDTMIKDALWDAFNNYHMGVTAENIAKQWGLTREEQDAFSA
ASQQKAEAAIKSGRFKDEIVPVVIPQRKGEPKVFDTDEFPRFGTTAETLAKLKPAFIKDG
TVTAGNASGINDGAAAFVVMSAEKAEELGLKPMAKILSYGSKGLDPAIMGYGPFHATKKA
LEKANLTVEDLDLIEANEAFAAQSLAVAKDLKFDMSKVNVNGGAIALGHPVGASGARILV
TLLHEMEKRDAKKGLATLCIGGGMGTALIVERI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagagaggtagttattgtaagtgcagtaagaacagcattaggtagttttggtggagca
ttaaaagatgtctcagcagtagatttaggagctttagtaattaaagaagccgtaaataga
gctggagtaaaacctgaattaattgaagaagttattatgggtaatgtaattcaagctggt
cttggtcaaaataccgcaagacaatcaacaataaaagctggattaccacaagaagtttca
gctatgactattaataaggtttgtggatcaggtcttagagcagttagtttagcagcacaa
atgattaaagcaggagatgctgatgttgttgttgctggaggtatggaaaatatgtcagct
gccccatatgcattggacaaagcaagatggggacaaagaatgggcgatggtaaattagtt
gatacaatgataaaagacgcattatgggatgcttttaacaactaccatatgggagttaca
gctgaaaatattgctaaacaatggggattaactagagaagagcaagatgctttctcagct
gcatctcaacaaaaagctgaagcagcaattaaatctggaagatttaaagatgaaatagtt
ccagttgttattccacaaagaaagggagaaccaaaagtatttgatacagatgaattccca
agattcggaacaacagcagaaactttagctaaattaaagccagcatttattaaagatggt
actgttacagcaggtaatgcatcaggtattaatgatggagcagcagcttttgttgttatg
agtgcagaaaaagcagaagaattaggacttaagccaatggctaaaatactttcttatggt
tcaaaaggattagatccagctatcatgggatatggaccattccatgcaactaagaaagct
ttagaaaaagctaacttaacagtagaagatttagatttaatcgaagctaatgaagctttt
gctgctcaaagcttagcagttgctaaagatttaaaattcgatatgtcaaaagttaatgta
aatggtggagcaattgctttaggtcatccagttggagcatcaggtgcaagaatattagta
actcttcttcatgaaatggaaaagagagatgctaaaaaaggattagctacactttgtata
ggtggcggaatgggaacagcacttatcgttgaaagaatttaa

DBGET integrated database retrieval system