KEGG   Clostridium beijerinckii ATCC 35702: Cbs_1828Help
Entry
Cbs_1828          CDS       T03415                                 

Definition
(GenBank) bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase protein
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
cbz  Clostridium beijerinckii ATCC 35702
Pathway
cbz00270  Cysteine and methionine metabolism
cbz00670  One carbon pool by folate
cbz01100  Metabolic pathways
cbz01110  Biosynthesis of secondary metabolites
cbz01120  Microbial metabolism in diverse environments
cbz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cbz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Cbs_1828
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Cbs_1828
Enzymes [BR:cbz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Cbs_1828
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     Cbs_1828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans MTHFR Spc29
Motif
Other DBs
NCBI-ProteinID: AIU00528
Position
2115022..2116803
Genome map
AA seq 593 aa AA seqDB search
MIKELLKNDILICDGAMGTYYSEVTGNDVSYCEFGNLNDKETIKRIHKEYIEAGAKLIRT
NTFSANTYDLGVSLETLMDIIKSGINLAKEVTRNTSVLIGASIGPIKTDNLDEFSNEVLE
EYKYIVDCFLKNGIDIFIFETFSNYNCLKKISEYIKYKNIDSFILTQFAVKPDGFTRDGL
SAAKLIKEVRNTKYIDAFGFNCGSGPAHILEMVKKINIENEIVSVLPNAGYPEIIHERTV
YPNNPVYFAKKVNEIRSFGVSIIGGCCGTNPSYIKQLTQIVNENSKVVNANAKAEPKVKS
FEKKAKNTFKDKLENGEFVVAIELSAPIDTDISRIIDGAKICKENNIDLVTVPDSPMSKV
RADSTIISSKIKREIGIEAMPHVCCRDKNTNAIRSSLIGSHIENIRNILAITGDPISDAS
KVETKSVFNLNSFRLIELIESMNEEIFKEDSIYVGGALNLNVLNKEVEYNRMMKKIEKGA
KFFLTQPIYDDNAIEFLKMIKERTNVKILAGLLPVVSYRNAMFLNNELPGVTIPDKYVQM
FSENMSKEEAQEIGVKITVEIGKKLKGIADGLYFITPFNRVNMLIEIIKQINA
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagagctattaaaaaatgatatactaatatgtgatggagcaatgggaacatat
tattcagaagtaacaggtaatgatgtatcctattgtgaatttggtaacttaaatgataaa
gaaactataaaaagaatacataaagagtatattgaagcaggggctaaactaattagaaca
aatactttttctgctaatacatatgatcttggagtatcgttagaaacattaatggacata
attaagtcaggaataaacttagctaaagaagtaacaagaaatacttctgttttaataggt
gcaagtattggacctattaaaacagataatttagatgaatttagcaatgaagttttagaa
gaatataaatacatagtagattgctttttaaaaaatggtatagatatttttatattcgaa
acttttagcaactataattgcctgaaaaaaataagcgagtatattaagtacaagaatata
gatagtttcatacttactcagtttgctgttaagccagatggatttacaagagatgggtta
agtgcagctaaattgattaaagaagtgcgaaatacaaaatatatagatgcatttgggttt
aattgtggttctggcccagcacatatattggaaatggttaaaaaaattaatatagaaaat
gaaattgtttcggtgctgcctaatgcaggttatccagagataattcacgaaagaacagtt
tatccaaacaatccagtatattttgcaaaaaaagttaatgaaataaggtcttttggagtt
tctattataggaggatgctgtggaacaaatccaagctacattaaacaactaacccaaata
gttaatgagaattctaaagtagtcaatgctaatgctaaagctgagccaaaagttaaaagt
tttgagaaaaaggctaagaatacttttaaagataagctcgaaaatggtgagtttgttgta
gctatagaattatcggcaccaattgataccgatatatcaagaattatagatggagctaag
atatgtaaagaaaacaatattgatttagtaacagttccggattcaccaatgtcgaaggtt
agggcagattcaactattatatcatctaaaatcaagagagaaataggaattgaagctatg
cctcatgtttgttgtagagataaaaatactaatgcaataaggtcaagtctgataggatct
catattgaaaatataagaaatatccttgcaattactggtgaccctatatctgatgctagt
aaagttgaaacaaaaagcgtatttaatttaaattcatttaggctaatagaattaatagaa
agcatgaatgaagaaatattcaaagaagatagtatttatgtaggtggtgctttgaatttg
aatgttttaaataaagaagtagaatataatagaatgatgaagaagatagaaaaaggtgca
aagttttttttaacgcaacctatctatgatgacaatgctatagagttcttgaaaatgatt
aaagagaggactaatgtaaagattttagcgggattacttcccgttgtaagttatagaaac
gcaatgtttttaaataatgagcttcctggagtaactataccagataaatatgtacaaatg
ttttcagaaaatatgagcaaagaagaggcacaagaaatcggtgtaaaaattactgtggaa
ataggaaagaaactaaaaggtattgcagatggattatatttcattactccttttaatagg
gttaatatgttaattgaaattattaagcagattaatgcctaa

DBGET integrated database retrieval system