KEGG   Clostridium beijerinckii ATCC 35702: Cbs_4881Help
Entry
Cbs_4881          CDS       T03415                                 

Definition
(GenBank) hexapeptide transferase family protein
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
cbz  Clostridium beijerinckii ATCC 35702
Pathway
cbz00520  Amino sugar and nucleotide sugar metabolism
cbz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cbs_4881
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:cbz01005]
    Cbs_4881
Enzymes [BR:cbz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     Cbs_4881
Lipopolysaccharide biosynthesis proteins [BR:cbz01005]
 Unusual sugar
  Cbs_4881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 DUF4954
Motif
Other DBs
NCBI-ProteinID: AIU01486
Position
complement(5713435..5714010)
Genome map
AA seq 191 aa AA seqDB search
MDKNYFVHESSYIDNDVVIGDGTKIWHFSHIMSNSVIGEKCNIGQNVVISPGVKIGDGVK
IQNNVSVYTGVICEDYVFLGPSCVFTNVVNPRSFIERKSEYKETIIGKGASIGANVTIVC
GHNIGKYALVGAGAVVTKHIPDYALVVGNPASIIGYVCECGEKLNFKDEHATCKACGKKY
SKDKEKVECID
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggataagaattattttgtacatgaatcaagttacattgataacgacgtagtgataggt
gacggaacgaagatttggcacttctctcatataatgagtaattctgtaattggagaaaag
tgtaatataggtcaaaacgttgtaatatcgcctggtgtaaaaattggagatggagtaaag
atacaaaataatgtgtctgtatatacaggagttatttgcgaagattatgtattcttagga
ccgtcttgtgtgtttactaatgtagtaaatccaagaagctttattgaaagaaaaagcgag
tataaagaaactataattggaaaaggggcttctataggtgctaatgtaacaattgtgtgc
ggtcataatatagggaaatatgcattagtaggtgctggagcagtagttactaaacacata
cctgattatgccttagtagtaggcaatccggcaagtatcataggatatgtatgtgaatgt
ggagaaaagttgaactttaaagatgagcatgcaacttgtaaagcttgtgggaaaaagtat
agcaaagataaagaaaaagtagaatgtatagattag

DBGET integrated database retrieval system