KEGG   Chlamydia caviae: CCA_00729
Entry
CCA_00729         CDS       T00125                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cca  Chlamydia caviae
SSDB
Motif
Pfam: OprB DUF2550
Other DBs
NCBI-ProteinID: AAP05470
UniProt: Q822F4
Position
834984..836339
AA seq 451 aa
MASFHSSLLTALCTLCTYGILTMPAYGLDPNHPKHHYHKYSERLKRSNAEDSAFYLSSAS
ESSEDLRQEPRRHILTPVRNVLKDDPCDEGLSISKLLHSIEKETNSQISVDFTILPQWFY
PKKSALATSEEKQPTWQFYVSPNISWQLYNSPTAGVGSIDFSYTLIRYWNNSAQNANNAI
GIAGEINDYSSRTNTLSLLTFSQTFPGEMLTVSFGQYSLYSIDGTLYDNDQQCGFLSYAL
SQNASATYSSGSVGAYVQFTPIPSINIQAGFQDAYSIVGSSFDVYNLTKNRYNFYGYFSW
APQSCLGAGQYSALIYSTRNVPQQPVQTTGWSLNFGQYLGEKLYVFGRWNGSTGTAVNLN
RSHVLGLASANPINRNPKDLLGAACSMSKVNPKVVTDKKIRKYETVIETFATVGFGPHLS
LSPDLQVYIHPARRPDRRSATVYSIRANFFV
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggcgtcttttcattcttccctattaaccgctctatgtactttatgtacttacggtata
ttgacgatgcctgcttatggactcgatcctaaccaccctaagcatcactatcataaatat
tccgaacgattgaaaagaagtaatgctgaagattctgccttttatttatcttcggcatca
gaatcctctgaagacttacgccaagaacctcgtcgtcacatacttaccccagttcgcaat
gttctaaaagatgacccctgcgacgagggactgtcgatctcaaaattgttgcactcgatt
gaaaaagagactaattctcaaatatctgtggattttaccattctccctcaatggttttat
cctaagaaaagtgcccttgcaacaagtgaagaaaagcagcctacttggcaattttatgtg
agtcctaacatctcctggcaactatacaatagtccaacagcaggtgtaggaagtatcgat
ttttcctatacattaatacgttattggaacaactctgcacaaaatgccaacaatgctata
ggcattgccggcgagatcaacgattacagctctcgaaccaatacgctatctctgctcaca
ttttcccaaacattccctggggagatgcttaccgtttcgtttggccaatacagcctatat
tctatagacggaactttatacgataacgatcagcaatgtggtttcttaagttacgcccta
tcgcaaaatgctagcgcgacatattcctcaggaagcgtgggagcttatgtacaatttacg
cctatcccttctataaatatccaagctggttttcaagatgcctatagtattgtaggctct
tcttttgatgtctataacctcacgaaaaatcgatacaatttctatggttatttctcttgg
gcgccacaaagttgtctaggtgctgggcaatattctgcattaatctattctacaagaaat
gttcctcaacagcctgtccaaacgacaggatggtcgctgaacttcggtcaataccttggg
gaaaaactgtatgtctttggaagatggaacgggtctacaggaacagcagtaaaccttaac
cgttctcatgttcttggattagcgtcagcaaatcctattaaccgcaaccctaaagatctg
ttgggagcggcttgctcaatgagtaaagttaaccctaaagtcgttacagataaaaaaatt
cgcaaatatgaaactgtaatagaaacattcgcaactgtaggatttggtcctcatctttcc
ctatctccagatctgcaagtctacatccatccagcacgaagaccagatagacgttctgca
actgtttacagtattcgagccaacttctttgtctaa

DBGET integrated database retrieval system