KEGG   Chlamydia caviae: CCA_00934Help
Entry
CCA_00934         CDS       T00125                                 

Gene name
lipA
Definition
(GenBank) lipoate synthase
  KO
K03644  lipoyl synthase [EC:2.8.1.8]
Organism
cca  Chlamydia caviae
Pathway
cca00785  Lipoic acid metabolism
cca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cca00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    CCA_00934 (lipA)
Enzymes [BR:cca01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     CCA_00934 (lipA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM LIAS_N
Motif
Other DBs
NCBI-ProteinID: AAP05673
UniProt: Q821K6
Position
1086151..1087089
Genome map
AA seq 312 aa AA seqDB search
MNTPSDETRKPPQGKRFAERLPKWLRQVLPTGPVFAQTDTTIKRTGMATVCEEALCPNRA
CCWSRKTATYLALGDACTRRCGFCNIDFTKKPISPDPEEPQKIAESAKILQLKHIVLTMV
ARDDLEDGGASFLVRIIDTLHQELPESTVEVLASDFQGNIDALHTLLDSGLTIYNHNVET
VERLTPVVRHKATYRRSLFMLEQAAMYLPDLKIKSGIMVGLGEQESEVKQTLKDLADHGV
KIVTIGQYLRPSRSHIPVKSYVTPETFDYYRTIGTSLGLFVYAGPFVRSSFNADIVLHNL
ENKQSDVAKMQN
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaccttccgatgaaacacgaaaacctccacaaggtaaacgtttcgccgagcgt
cttcccaaatggctaaggcaagttttacctactggtccagtctttgcccaaacagataca
acgataaagcgcacgggaatggccacggtatgcgaagaagctctatgtcccaatcgggca
tgttgctggtcaagaaagacagcaacctatctagctttaggagatgcgtgcacaagacgt
tgtggtttctgtaacattgacttcacgaaaaagcctatctcccctgatcctgaagaacct
caaaaaattgcagaatcagcaaaaattcttcagcttaagcatattgttttaaccatggta
gcccgtgatgatctagaagatggcggtgcaagttttctcgtgcgtattattgatactcta
catcaagagcttccagaatctactgtcgaggtattagcttcagactttcaaggaaacatt
gatgctttacacacactattggattcaggattaaccatttataatcataatgtggaaacg
gttgaacgtctcacacctgtagtacgtcataaagcaacatatcgtcgttctttatttatg
ttagagcaagcggctatgtatctccctgatcttaagattaaatcaggaattatggtgggt
cttggagagcaggaaagcgaggtaaaacaaacgctaaaagatcttgcagatcacggagtg
aaaatcgtcaccataggacagtatttacgtccttcccgatcacatataccagtaaaaagc
tacgttactcccgagacttttgattactaccgtacaataggaacgtctttagggcttttt
gtctatgcaggaccttttgttcgttctagtttcaatgcagatatcgtcttgcataatctg
gagaacaaacaatctgatgtagcaaaaatgcagaattag

DBGET integrated database retrieval system