KEGG   Cyanistes caeruleus (blue tit): 111922569Help
Entry
111922569         CDS       T05602                                 

Gene name
METTL3
Definition
(RefSeq) N6-adenosine-methyltransferase catalytic subunit
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
ccae  Cyanistes caeruleus (blue tit)
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ccae03019]
    111922569 (METTL3)
Enzymes [BR:ccae01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     111922569 (METTL3)
Messenger RNA biogenesis [BR:ccae03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     111922569 (METTL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70
Motif
Other DBs
NCBI-GeneID: 111922569
NCBI-ProteinID: XP_023773881
Position
Unknown
AA seq 222 aa AA seqDB search
PIPAVFSPFLLPWQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLN
IPVLQDEGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNH
GKEHCLVGVKGNPQGFNRGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPH
NVQPNWITLGNQLDGIHLLDPDVVAQFKQHYPDGIISKPKNL
NT seq 671 nt NT seq  +upstreamnt  +downstreamnt
gaccgattcccgccgttttctccccgtttctcctcccctggcagtggatctgctgcgaca
ttcgctacctggacgtctccatcctgggcaagttcgccgtggtgatggcggatccgccct
gggacatccacatggagctgccctacggaacgctgaccgacgacgagatgcggcgcctca
acatccccgtgctgcaggacgagggcttcctcttcctctgggtcaccggcagggccatgg
agctgggccgtgagtgcctcaatctctgggggtacgagcgcgtggacgagatcatctggg
tgaagacgaatcagctgcagcgaatcatccgcacgggacgcaccggccactggctcaacc
acggcaaggagcactgcctggtgggggtgaaggggaacccccagggcttcaaccggggcc
tggattgtgacgtcatcgtggccgaggtgcgctcgaccagccacaaacccgacgagattt
acgggatgatcgagcggctctcgccgggaacgcggaaaatcgaactcttcggccgccccc
acaacgtccagcccaactggatcaccctgggcaatcagctggacgggattcacctgctgg
accccgacgtggtggcgcagttcaagcagcattaccccgacggcatcatctccaaaccca
aaaacctctga

DBGET integrated database retrieval system