KEGG   Cyanistes caeruleus (blue tit): 111923520Help
Entry
111923520         CDS       T05602                                 

Gene name
MTMR6
Definition
(RefSeq) myotubularin-related protein 6
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00562  Inositol phosphate metabolism
ccae01100  Metabolic pathways
ccae04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111923520 (MTMR6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    111923520 (MTMR6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccae01009]
    111923520 (MTMR6)
Enzymes [BR:ccae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     111923520 (MTMR6)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     111923520 (MTMR6)
Protein phosphatases and associated proteins [BR:ccae01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    111923520 (MTMR6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related Y_phosphatase DUF2353 DSPc Y_phosphatase3 Xylo_C
Motif
Other DBs
NCBI-GeneID: 111923520
NCBI-ProteinID: XP_023775061
Position
1
AA seq 622 aa AA seqDB search
MEHIRTTKVEQVKLLDRFSTSNKSLTGTLYLTATHLLFIDSSQRETWILHHHIAAVEKLP
LTTSGCPLVIQCKNFRIVHFVVPRERDCHDIYNSLLQLSRTAKYEELYAFSYNPKQNESE
QVKGWQLIDLAEEYKRMGVPNDYWQLSDANRDYKICETYPRELYVPRTASKPIIVGSSKF
RSKGRFPVLSYYHKNKEAAICRCSQPLSGFSARCLEDEHMLQAISKANPSNRYMYVMDTR
PKLNAMANRAAGKGYENEDNYSNIRFQFVGIENIHVMRSSLQKLLEVSGTRGLSVNDFLS
GLENSGWLRHIKAVLDAAVFLAKAIAVESASVLVHCSDGWDRTSQVCSLGALLLDSYYRT
IKGFMVLIEKDWISFGHKFSDRCCQLDGDPKEISPVFTQFLESVWNLTEQFPQAFEYNEA
FLLQIHEHVHSCQFGNFLGNCQKEREELKLKEKTYSLWPFLLAEQKKYQNPLYNPDFSPE
LTLLEPNTVSFNFKFWRNMYHQFDRSMHPRQSMLNLIMNTSEQNKQLEEDIKELEAKIKQ
RNGQSDVVLVKKQEQTAHPAPVALKSPPCFQKEQPPMPVNDAVRTIEGSNTADNRYSELV
SEFSKAEPAVVSLEYGVARMTC
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggagcacatccgcaccaccaaggtggagcaggtgaaattactggataggttcagcaca
agcaataagtcactgacgggaactctgtaccttacagcaactcatctgttattcatagat
tcaagccagagagagacgtggatactacatcatcacattgctgcagttgaaaaacttcct
ttgactacttctggctgcccccttgtcatccagtgcaagaacttcaggatagttcacttt
gtggtacctagagagagagattgtcatgacatctataattctttgcttcagctctccaga
acagcaaaatatgaagaactctatgccttttcttataatccaaaacaaaatgaatctgag
caagtcaaaggttggcagcttattgatctagcagaagaatataagagaatgggagtgcca
aatgattactggcagttgtctgatgcaaaccgtgattacaagatttgtgaaacctatcct
agagaactttatgttcccagaactgcaagcaagcccataattgttggtagctccaagttc
agaagtaaaggaagattcccagtgttgtcatattatcataaaaataaagaggctgcaatt
tgcagatgcagtcaacctctctcaggtttcagtgccaggtgcctggaagatgagcacatg
ttgcaagccatcagtaaagcaaatccttcaaatcgctacatgtacgtcatggatacccgg
ccaaagcttaatgcaatggcaaacagagctgctgggaagggctatgagaatgaagacaac
tactcaaacattaggttccagtttgttggcattgaaaatattcatgtaatgagatctagc
ttgcaaaaactcctggaagtcagtggcacaaggggtttgtctgtcaatgactttttgtct
ggtctggagaattctggatggctgcgtcacatcaaagctgtattggatgctgcggtcttc
ctagccaaggcaatagcagttgagagtgcaagtgtattggtgcactgttcagatggctgg
gataggacttcccaagtttgttcccttggagctctcttgctagattcctattacagaaca
atcaaaggattcatggtcttgatagagaaagactggatctcctttggacacaagttctct
gacagatgttgtcagttggatggtgatccaaaagagatctcaccagtgttcacccagttt
ttagaaagtgtgtggaatctgactgagcagtttccacaagcctttgagtacaatgaagct
ttcctccttcaaatccatgaacatgtccattcatgccagtttggcaacttccttggaaat
tgtcaaaaagaacgagaagagctaaaactaaaagagaagacctattcgttgtggccgttc
cttttggctgaacagaagaaatatcagaatcccctatataatccagatttttctccagaa
ctaactcttttggagcctaatacagtatcattcaattttaagttttggagaaatatgtat
catcagtttgatcgaagtatgcatcccaggcaatctatgctcaaccttatcatgaataca
agtgagcaaaataaacaactggaggaagacattaaagaactggaagctaaaataaagcag
agaaacgggcagtcagatgtggtccttgtgaagaagcaggagcagacggctcatcctgcc
cccgtggcgctgaagtcccctccgtgcttccagaaggagcagccgccgatgccagtgaat
gacgccgtgcgaaccatagagggcagcaacacagcggacaatcgctacagcgaactcgtg
tccgagttctccaaagctgagcctgccgttgtcagcttggagtacggagtggccaggatg
acctgctaa

DBGET integrated database retrieval system