KEGG   Cyanistes caeruleus (blue tit): 111924322Help
Entry
111924322         CDS       T05602                                 

Definition
(RefSeq) stromelysin-1-like
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
ccae  Cyanistes caeruleus (blue tit)
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ccae01002]
    111924322
Enzymes [BR:ccae01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     111924322
Peptidases [BR:ccae01002]
 Metallo Peptidases
  Family M10
   111924322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Reprolysin_3 DUF4953 Reprolysin_5 Reprolysin_4 Peptidase_M57
Motif
Other DBs
NCBI-GeneID: 111924322
NCBI-ProteinID: XP_023776261
Position
1
AA seq 503 aa AA seqDB search
MKTKILLFLELLYVTCSSAFPVAPEKEKEDMQFAKKYLENFYDFKEEKHSLFKAKDLNHM
SDKIREMQSFFGLEVTGELNQKTLDMMKQPRCGIPDIRSYSAFPHSPTWKKEDVTYRILN
YTPDMLQADVEEAIARAFQLWSSVTPLRFTRIYGGQADIMISFASGFHGDFYSFDGPGGT
LAHAYPPGSGIGGDAHFDEDENWTKFTTYSGFNLFLVAAHELGHSLGLSHSNVFGALMYP
IYMATDTRYYQLHQDDIDGIQALYGPPKESAALPTKAFPPQEPTEMVPAEAPTQMPPRED
PTEITPSKQPQRPDDCDPHLTFDAITTLRGETLFFKGSYIWRKSPYFSEIEHDTIFSFWP
SLIAGFDAAYEVDKKDRVLFFKDDQYWAVSGYRIDSGFPKPIQNLGFPTSVRKIDAAVHD
QSTKRTYFFVGNKYWSFNENTQSMERGYPRRIVPDFQGISHPIDAALQKNGYFYFFHGSN
QYEVDIKRKKLIRIMKSNSWFNC
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaaagatccttcttttccttgagttattatatgttacatgctcctctgctttc
ccagtggctccagaaaaggaaaaagaagatatgcaatttgctaagaaataccttgaaaac
ttctatgattttaaagaagagaaacattctctgtttaaagcaaaggacctcaaccacatg
tctgataaaatacgagagatgcagtcattctttgggctagaggtgactggggagctgaat
cagaagacgctggacatgatgaagcagcctagatgtggaataccagacatccgttcgtac
agcgccttcccacacagccccacatggaagaaagaagacgtgacctatcggattttgaac
tacactccagacatgctgcaagctgatgtagaggaagcaattgcaagagccttccagctc
tggagcagtgtcacccctctgaggttcaccaggatctacggcggtcaagcagatataatg
atttcctttgcatctggatttcatggtgacttctattcctttgatggtccaggaggaact
ctggctcatgcctacccccctggcagtgggataggaggagatgctcattttgatgaagat
gaaaactggaccaaatttacgacctatagtggattcaacttatttcttgttgctgctcat
gagttgggccactcactaggtctcagtcattccaatgttttcggtgctttgatgtatcct
atatatatggccacggatacgaggtactaccaacttcatcaggatgacattgatggcatt
caagccctctatggaccccccaaggaatctgctgcacttccaacaaaagcttttcccccg
caagaaccaactgaaatggtacctgcagaagcaccaactcaaatgcctcccagggaagat
ccaacagaaattacaccctccaagcaaccccaaagaccagatgactgtgaccctcatctg
acttttgacgctatcactactctccgtggggaaacactgttcttcaaagggagctatatc
tggcgcaaaagtccatatttctcagaaattgagcacgacaccatcttctccttctggcca
tcactgatagctggctttgatgctgcatatgaggttgacaagaaggaccgagtgctattt
tttaaagatgatcagtactgggctgtcagtggctacagaatagactcggggttccccaag
cccattcagaacctgggcttccccaccagtgtcagaaaaatcgatgcagctgttcatgac
caaagtaccaagagaacctatttctttgtcggcaacaagtactggagtttcaatgaaaat
acccaatcaatggaaagaggctatccacgaagaattgttcctgacttccaggggatcagc
catccaattgatgctgcccttcagaaaaatggatatttctactttttccatggatcgaac
cagtatgaggttgacatcaaaaggaagaaactcatccgtataatgaaaagcaacagctgg
tttaattgttag

DBGET integrated database retrieval system