KEGG   Cyanistes caeruleus (blue tit): 111924950Help
Entry
111924950         CDS       T05602                                 

Gene name
ROCK1
Definition
(RefSeq) rho-associated protein kinase 1 isoform X1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04270  Vascular smooth muscle contraction
ccae04350  TGF-beta signaling pathway
ccae04510  Focal adhesion
ccae04530  Tight junction
ccae04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    111924950 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111924950 (ROCK1)
   04530 Tight junction
    111924950 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111924950 (ROCK1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111924950 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccae01001]
    111924950 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccae03036]
    111924950 (ROCK1)
Enzymes [BR:ccae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111924950 (ROCK1)
Protein kinases [BR:ccae01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   111924950 (ROCK1)
Chromosome and associated proteins [BR:ccae03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111924950 (ROCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH Cortex-I_coil C1_1 APH Pkinase_C DUF1192
Motif
Other DBs
NCBI-GeneID: 111924950
NCBI-ProteinID: XP_023777039
Position
2
AA seq 1366 aa AA seqDB search
MSSGESFESRFEKIDVTLKDPKSEVNVDCLLDGLDALVYDLDFPALRKNKNIDNFLNRYK
DTVNKMRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSSRRVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKAGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDSDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLGVPAENSNDNRTGS
SVDKSVLENMQKMIYELEEQLHNEMQLKDEMEQKCRSSNIKLDKIMKELDEEGSQRKNLE
TTVSQIEKDKMVLQHKINEYQRKFEQENEKRRNVENEVSTLKDQMEDLKKISQHSQISNE
KITQLQKQLEEANDLLRTESDTAARLRKGNTEMSKSLSQVESLNRELQERCRVLESTKLQ
VEKDYYQLQAALESERRDRSHGSEMIGELQVRITALQEEVKNIKNNLDRVEAERKQAQDM
LNHSEKEKNNLEIDLNYKLKSLQDRLEQEVNEHKVTKARLTDKHQSIEEARSVAMCEMEK
KIREERAAREKAENRIVQAEKQCSMLDFDLKQSQQKLEHLLQQKERLEDEVRNLTLKLEQ
ETNKRIMAQNELKAQAFEADNLKGSEKQLKQEINTLLEAKRLLEFELAQLAKQYRGNEGQ
MRELQDQLEAEQYFSTLYKTQVKELKEEIDERNKETQRKMQELQNEKETLATQLDLAETK
AESERLARALAEEQYYELNQESKKAASRHRQELTDKDIIIRRLEETNNTLTKDVDLITKE
NTEISEKFKKQEEDYKMKKEEEINNIRMHYEKSINTERTLKTQAVNKLAEIMNRKDFKID
RKKANMQDLRKKEKENRKLQLELNQEKEKFNQIVVKYQKELNEMQAQLAEESTYRNELQM
QLDSKESDIEQLRRKIMDLQQGMDSTSVASLPTDETDGNLSESRLEGWLSVPNKGNIRRH
GWKKQYVVVSSKKILFYNDEKDKDQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIF
QILYANEGECRKDLEVEPVQPAEKTNFLNHKGHEFIPTLYHFPANCEACAKPLWHVFKPP
AALECRRCHVKCHRDHLDKKEELIAPCKVSYDVTSARDMLLLASCQDEQKKWVTHLVKKI
PKTPPSTFVRASPRTLSTRSSANQSFRKVVKNTSGKTRQYSRTCPR
NT seq 4101 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgggagaaagttttgagtctcgatttgagaaaatcgacgtgactttgaaggac
cccaagtccgaagtgaacgtggactgtttgctggatggattagatgctttggtatatgac
ttggattttcctgccttaagaaaaaataagaacattgataacttcttaaacaggtataaa
gacacagtaaacaaaatgagggatctgcgcatgaaagctgaagattatgaagtggtgaag
gtgatcggtagaggggcatttggggaggttcagttggtgaggcataaatcctcaaggaga
gtgtatgctatgaaacttctgagcaaatttgagatgatcaaaagatctgattctgcattc
ttctgggaagaaagggatattatggcttttgctaatagtccctgggttgttcagttattt
tacgcattccaagatgaccgttacctttacatggtgatggaatacatgcctggtggggac
cttgtgaatttaatgagtaattacgatgttccagagaaatgggcaagattttatactgct
gaagttgtacttgcattagatgcaattcactcaatgggttttatacacagagatgtgaag
cctgataatatgctgctagataaagctggtcatttaaaattagcagattttggtacttgt
atgaagatgaacaaggaaggaatggtacgatgtgacacggctgtgggaacaccagactac
atctctcctgaagtgttgaagtcccagggaggggatggttattatgggcgggaatgtgac
tggtggtcagttggagtcttcttgtatgagatgcttgtaggtgatacacctttttatgca
gactctttggttggaacatacagtaagattatgaaccataagaactcccttactttccct
gacgacagtgacatttctaaagaggcaaaaaacctcatttgtgcctttttaactgatagg
gaagtgaggttaggacgaaatggtgtagaagaaattaaacggcaccttttcttcaaaaat
gatcagtgggcttgggaaacactcagagacacggtagcaccagttgtgcctgacttaagt
agtgacattgacactagtaattttgatgatctggaagaagacaaaggagaggaagaaaca
tttcccataccaaaagcatttgtgggcaaccagcttccttttgtaggatttacgtactac
agcaaccgtcggtatttaggtgtccctgcagaaaattccaatgacaacagaacgggctcc
agtgtggacaaaagtgtgctggaaaatatgcagaagatgatctatgagttagaagaacag
ctacataatgaaatgcagttgaaagatgaaatggagcaaaagtgcagatcttcaaacata
aagctagacaagataatgaaagaactggatgaagagggcagtcagaggaagaacttggaa
acaacagtgtctcagattgagaaggacaagatggtgttacaacataaaataaatgagtac
caaagaaaatttgaacaagagaatgaaaaaagacgtaatgtggaaaatgaagtgtccaca
ctaaaagatcagatggaagacttgaaaaaaataagccagcattcacaaatttcaaatgag
aagataacacagttacaaaaacaacttgaagaagcaaatgatttgctgaggacagaatct
gacacagctgcaagactgagaaagggtaacacagaaatgagcaagtcattaagtcaggta
gaatcactgaatagagagctgcaagaaaggtgcagagttctggaaagcacaaaactgcag
gtggagaaggattattaccaactacaagcagctttggagtcagaacgaagggacagaagt
catggatctgaaatgattggagaattacaggttcggattacagctttacaagaagaagta
aaaaacattaaaaacaatcttgatcgagtggaagcggaaagaaaacaagcacaggatatg
cttaaccattcagaaaaggaaaagaataatttagagatagatttgaactacaaactgaaa
tccttacaagaccggttagaacaggaagtcaatgagcacaaagtgactaaagcacggtta
actgacaagcaccagtcaatagaggaggcaagatcagttgcgatgtgtgaaatggaaaaa
aagataagggaagaacgggcagcaagagagaaggcagaaaatagaatagttcaagctgaa
aaacagtgttccatgctggactttgacttgaagcaatctcagcagaaactggaacatctt
cttcagcaaaaggaaagactggaagatgaagtaaggaatctgacacttaagctagaacaa
gagacaaataagcgaataatggcacagaatgaattaaaggcacaagcttttgaagctgat
aacttgaagggttctgagaagcagctgaaacaggaaatcaataccttgttggaagcaaag
agattactggaatttgagctggctcaacttgcaaaacagtacagaggaaatgaaggtcag
atgcgtgagcttcaggatcagcttgaagctgagcagtatttttcgacactttacaaaact
caggttaaggaactgaaagaggaaattgatgaaaggaataaagaaacacaaagaaaaatg
caggagttgcagaatgaaaaagaaacacttgctacccagttggatttagctgaaaccaaa
gctgagtcagaacggttggcacgggcacttgctgaagaacagtattatgaactgaatcag
gaaagcaaaaaagctgcatcaaggcacagacaagaattgactgataaggacatcatcata
agaaggctggaagaaactaataacactttaaccaaagatgttgatttaataacaaaggaa
aacacagagatcagtgaaaaatttaagaaacaagaggaagattacaaaatgaaaaaagag
gaggaaatcaataatattagaatgcattatgagaagagcataaacactgaaagaactctg
aagacacaggctgtcaacaaactggctgagataatgaatcggaaagattttaaaatagac
agaaagaaagctaacatgcaagatttgaggaagaaggagaaggaaaaccgaaagctccaa
ttagaacttaatcaagaaaaggagaaattcaatcagatagtcgtgaaataccaaaaggaa
cttaatgaaatgcaagcgcaactagcagaagaatcaacatacaggaatgagctccagatg
cagctggatagtaaagagagtgacatagaacagctacgaaggaaaatcatggaccttcag
caaggaatggattctaccagtgttgccagtcttccgacagatgaaacggatggaaatctt
tcagaatcaagacttgaaggttggctttcagtaccaaacaaaggaaatataaggcggcat
ggctggaagaaacagtatgttgtggtgagcagtaaaaagatactgttctacaatgatgaa
aaagacaaggaccagtctaatccatccatggtactagatatagataagctgtttcatgtc
cggcctgtaactcaaggagatgtatatagagctgaaactgaagaaattcctaaaatattc
cagattctctatgctaatgagggggaatgcaggaaggatttggaggtagaaccagtacag
ccggcagagaagacaaattttctaaatcacaaaggccatgaatttattcccacgttatac
cactttccagccaactgtgaggcctgtgccaaacctctctggcatgtcttcaaaccccct
gctgccctagaatgtcgaagatgccatgtgaagtgccacagagaccacttagataaaaag
gaggaattaattgcaccgtgtaaagtgagttatgatgtaacttcagcaagagatatgctc
ttgttggcatcctgtcaagatgaacagaagaagtgggtgacgcatttagtaaagaagatc
cctaagacacctccatctacttttgttcgtgcttctcctagaactttgtctacaagatcc
tcagcaaaccagtcattccgaaaagttgttaaaaatacttccggaaaaactagacagtat
agcagaacttgccctcggtga

DBGET integrated database retrieval system