KEGG   Cyanistes caeruleus (blue tit): 111928324Help
Entry
111928324         CDS       T05602                                 

Gene name
SUCLG1
Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial isoform X1
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00020  Citrate cycle (TCA cycle)
ccae00640  Propanoate metabolism
ccae01100  Metabolic pathways
ccae01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111928324 (SUCLG1)
   00640 Propanoate metabolism
    111928324 (SUCLG1)
Enzymes [BR:ccae01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     111928324 (SUCLG1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     111928324 (SUCLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 111928324
NCBI-ProteinID: XP_023781486
Position
4
AA seq 348 aa AA seqDB search
MLPVCSFPLQAHFQIFHSPGSLECSPQGPAGGKDFQQNGVRHCSYTASRKNLYVNKSTKV
ICQGFTGKQGTFHSQQALEYGTNLVGGISPGKGGKTHLGLPVFNSVKEAKEQTGASATVI
YVPPPFAAAAINEAIDAEMPLVVCITEGIPQQDMVRVKHRLLRQSKTRLVGPNCPGVINP
GECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQTFCIGIGGDPFNGTNFID
CLDVFLKDPQTEGIILIGEIGGNAEEDAAAFLKENNSGPNPKPVVSFIAGLTAPPGRRMG
HAGAIIAGGKGGAKEKIAALQSAGVVVSMSPAQLGSTIYKEFEKRKLL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgttgcctgtttgttctttccccttgcaggcccattttcaaattttccattctcctgga
agcctggagtgttctccccaaggccctgctggtggtaaggactttcaacagaatggagtc
cgacattgctcctacacagcatccaggaaaaacctgtatgtcaacaaaagcacaaaggtt
atctgtcagggttttacaggcaaacagggcacctttcacagccagcaggcattggagtat
ggcaccaatctagttggaggaatttctccagggaaagggggaaaaactcatctaggtctg
cctgtgtttaattctgtgaaggaggccaaagaacaaacgggtgcttcagccactgtcatc
tacgtccctcccccatttgcagctgctgccatcaacgaggccatcgatgcagagatgccc
ctggtggtgtgcatcactgagggcatcccccagcaggacatggtgcgggtcaaacacagg
ctgctgcggcagagcaagacccggctggtgggccccaactgccctggagtcatcaatcct
ggagaatgtaaaattggtatcatgcctggtcacattcacaagaaaggaagaattggtatt
gtgtcaagatctggaaccctgacatacgaagctgttcatcagacaacacaagttggcttg
gggcagactttttgcattggtattggaggtgatcccttcaatggaactaattttattgac
tgccttgatgtcttcctgaaagatcctcaaactgaggggataatattgattggggagatt
ggaggaaatgctgaagaagatgcagcggcatttttgaaagaaaataattccggtcccaac
cccaagccagtggtgtccttcatagccgggctgacggctcctccgggccggcggatgggc
cacgctggagccatcattgctgggggaaaggggggagccaaggagaagattgcagccctc
cagagtgcaggggttgtggtcagcatgtcccctgctcagctgggcagcaccatctacaag
gagtttgagaaaaggaaattgctgtaa

DBGET integrated database retrieval system