KEGG   Cyanistes caeruleus (blue tit): 111929482
Entry
111929482         CDS       T05602                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00230  Purine metabolism
ccae00240  Pyrimidine metabolism
ccae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111929482 (DCK)
   00240 Pyrimidine metabolism
    111929482 (DCK)
Enzymes [BR:ccae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     111929482 (DCK)
SSDB
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_28 AAA_33 DUF5066
Other DBs
NCBI-GeneID: 111929482
NCBI-ProteinID: XP_023782855
Position
4
AA seq 257 aa
MATPPKRCRPGGRLKKVAVEGNIAAGKSTFVNILKQASEDWEVVFEPVARWCNVQQSSGD
DCEELTTSQKSGGNVLRMMYEKPERWAFTFQTYACLSRIRAQLNALDGKLRDAQNPVLFF
ERSVYSDRYIFAANLYESDCMNETEWTIYQDWHDWINKQFGSRLALDGIIYLRATPEKCL
NRIYLRGRDEEQEIPIEYLEKLHYKHESWLQHRTLRTDFDYLQEIPILTLDVNEDFKGKK
DRYDHMIEKVKEFLSTL
NT seq 774 nt   +upstreamnt  +downstreamnt
atggccaccccgcccaagcgctgcaggcccggcggccgcctcaagaaggtcgccgtggag
ggcaacatcgctgcagggaaatccacctttgtgaatattctgaaacaagccagcgaagac
tgggaggtggtttttgagcctgtagctagatggtgcaatgtccagcaaagctctggagac
gactgtgaggagctgaccacgtcacagaagagcggcgggaacgtgctgcggatgatgtac
gagaagccggagcgctgggcgttcaccttccagacgtacgcgtgcctcagcaggatccgg
gctcagctcaacgccctggatggcaaactccgggatgcgcagaatcccgtgctgttcttc
gagcgctctgtctacagcgacaggtacatctttgctgctaatctgtacgagtctgactgc
atgaatgagactgagtggacaatttaccaggactggcacgactggataaataaacagttt
ggctccaggctggcgctggatgggatcatttatctgcgagccactcctgagaaatgcttg
aataggatttatttacgtggaagagatgaggagcaagaaatccccattgaatatctggag
aagcttcactacaagcacgaaagctggctccagcacaggacactgcgaacagattttgac
tatctgcaggaaattcccattttaacgctcgatgttaacgaagacttcaaaggcaaaaag
gacagatacgatcacatgattgaaaaggtcaaggagtttttgagcacgttgtga

DBGET integrated database retrieval system