KEGG   Cyanistes caeruleus (blue tit): 111929734
Entry
111929734         CDS       T05602                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5 isoform X1
  KO
K16522  A-kinase anchor protein 5
Organism
ccae  Cyanistes caeruleus (blue tit)
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccae01009]
    111929734 (AKAP5)
Protein phosphatases and associated proteins [BR:ccae01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     111929734 (AKAP5)
SSDB
Motif
Pfam: Plasmodium_HRP
Other DBs
NCBI-GeneID: 111929734
NCBI-ProteinID: XP_023783160
Position
5
AA seq 811 aa
MVKAAKEIQMENPREAETPSTGATCSPPEEQAKKPSMLCFKKQKKSCKKGLTAKDACEGA
SEEKSQCVSADQEEAKASNPSRSSKGTWAAIKNLAKPRRRQKSSSRKKVPSDSQVQLEVD
AEESCARDLPKKRASSGVKMPCVRFSRGKKKPSPSEAVEESEGSVQANEVMGVVNKASEE
PEDLAPTDKSEPFSPVSAQEERDTVKQEQHRMKEDKDIMKEDQDTVKEDQDTGKEDQDTV
KEDHDTAKESDTSVGKSEPLTEPTRDAEEHSECTVQLEITHSETVDETAQDKLQEGSLPQ
ITNDAEGREVAPEAPVPKDQPDIPEITEWQEIPNTCKEMPERDELEKSINLPKECKAEES
VTDFSQLASGGDAANVQEAVSVQDVVSVQDVVSVQDVVSVQDAESVQDAVSVQDVVSVKD
VVSVQEAANVQDAVSVQDVTSVQDATSVQDVASVQEAVSVQEAASMQDATSVQDVMSVQE
AANVQDAVSAQVAESVQEAVSVQEAASAQDAVSAQDAVNVQEAVSAQDAVSAQDAVSTQD
AVSVQEAVNMQEAVSVQDAVSAQDAVSVQEAVSVQDAVSVQEAVNVQEAASVQDAVSAQD
AVSVQEAVSVQDAVSAQDVSSVQDAVSAQDVSSVQEAVSAQDVSSVQEAVSVQDAVSAQD
VSSVQEAVSAQDVSSVQEAVSVQECSSRQILEANTGAGVSIVITITEAEDSDNTDSDQAY
EPSPVLRQKKQKGNKKSNRNADVGQKEGPEAGGGPQAEEKGLGDQGHRTGEQYELLLVET
ASSLVKAAIQSSIEQLVNEMALEQNKHNSFL
NT seq 2436 nt   +upstreamnt  +downstreamnt
atggtgaaggcagctaaagaaattcaaatggagaacccaagagaggcagagactcccagc
acaggggccacatgttccccaccagaggaacaagcgaaaaaaccctctatgctctgtttt
aagaagcagaagaagtcctgtaagaaggggctgactgcgaaggatgcgtgcgaaggagcc
tcagaagagaaaagccaatgtgtcagcgctgaccaagaggaggcaaaagcttccaatcca
tcacgatcctccaaagggacttgggcagccatcaaaaaccttgccaaacctcggagaagg
cagaagtcctcctcacggaagaaggtgccctctgattcccaagtgcagctggaggtggat
gctgaggagagctgtgcgcgagacctcccaaagaaacgggcgagctctggggtgaagatg
ccctgtgtgagattctccagaggcaagaaaaaacccagcccctcagaagcagtggaggag
tcagagggcagtgttcaagcaaatgaagtgatgggtgttgtgaataaggctagtgaagag
ccagaggatttggccccgacggacaaatctgaacccttcagcccagtctctgcacaggag
gagcgggatacggtgaagcaggagcagcatagaatgaaagaggacaaggacataatgaaa
gaggatcaggatacagtgaaggaggaccaggatacggggaaggaggaccaggatacagtg
aaagaggaccacgatacagcaaaggaaagtgacacctctgtggggaagagtgagcccttg
acagagcccacacgtgatgcagaggaacactcagagtgcactgttcagttggagataacc
cattcagagacagttgatgaaacagcccaggacaaactgcaggaagggagcctaccccaa
atcaccaacgatgcagagggcagggaagttgctcctgaagcacctgttcctaaagaccaa
cctgacatccctgaaatcacagagtggcaggaaatccctaatacctgcaaagagatgcct
gaaagggatgaactggaaaagagcataaatcttcccaaggagtgcaaagccgaggagtct
gtaactgatttcagtcagttggcatctggaggtgatgcagcaaatgtgcaggaggcagtg
agtgtgcaggatgtagtgagtgtgcaggatgtagtgagtgtgcaggatgtagtgagtgtg
caggatgcagaaagtgtgcaggatgcagtgagtgtgcaggatgtagtgagtgtgaaggat
gtagtgagtgtccaagaggcagcgaatgtgcaggatgcagtgagtgtgcaggatgtcaca
agtgtgcaagatgccacgagtgtgcaggatgtggcaagtgtgcaggaggcagtgagtgtg
caggaggcagcaagcatgcaagatgccacaagtgtgcaggatgtcatgagtgtccaagag
gcagcgaatgtgcaggatgcagtgagtgcacaggttgcagagagtgtgcaggaggcagtg
agtgtgcaagaagcagcgagtgcgcaggatgcagtgagtgcacaggatgcagtgaatgtg
caagaagcagtgagtgcgcaggatgcagtgagtgcacaggatgcagtgagtacacaggat
gcagtgagtgtgcaagaggcagtgaatatgcaagaagcagtgagtgtgcaggatgcagtg
agtgcacaggatgcagtgagtgtgcaggaggcagtgagtgtgcaagatgcagtgagtgtg
caagaggcagtgaatgtgcaagaagcagcaagtgtgcaggatgcagtgagtgcacaggat
gcagtgagtgtgcaggaggcagtgagtgtgcaagatgcagtgagtgcacaggatgtatca
agtgtgcaggatgcagtgagtgcacaggatgtatcaagtgtgcaggaggcagtgagtgca
caggatgtatcaagtgtgcaggaggcagtgagtgtgcaggatgcagtgagtgcacaggat
gtatcaagtgtgcaggaggcagtgagtgcacaggatgtatcaagtgtgcaggaggcagtg
agtgtgcaggaatgctccagccgtcagatattagaagcaaatacaggtgctggtgtcagt
attgtcatcaccatcaccgaagctgaggactccgacaacaccgactctgaccaggcctat
gagccatccccagttttgcgccaaaaaaagcaaaaagggaataaaaaatcgaacaggaat
gctgatgttggtcaaaaagagggccccgaggctggtggtggtccccaggcagaggagaaa
ggtctgggtgaccaagggcacagaactggggagcagtacgagttgctccttgtagaaacc
gcctcttccctcgtgaaggcggccattcagtcatccatagagcagctggtcaacgaaatg
gccctggaacagaataaacacaacagctttctgtga

DBGET integrated database retrieval system