KEGG   Cyanistes caeruleus (blue tit): 111929737Help
Entry
111929737         CDS       T05602                                 

Gene name
HSPA2
Definition
(RefSeq) heat shock-related 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae03040  Spliceosome
ccae04010  MAPK signaling pathway
ccae04141  Protein processing in endoplasmic reticulum
ccae04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111929737 (HSPA2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111929737 (HSPA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111929737 (HSPA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111929737 (HSPA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccae01009]
    111929737 (HSPA2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ccae03041]
    111929737 (HSPA2)
   03009 Ribosome biogenesis [BR:ccae03009]
    111929737 (HSPA2)
   03110 Chaperones and folding catalysts [BR:ccae03110]
    111929737 (HSPA2)
   04131 Membrane trafficking [BR:ccae04131]
    111929737 (HSPA2)
   03051 Proteasome [BR:ccae03051]
    111929737 (HSPA2)
   03029 Mitochondrial biogenesis [BR:ccae03029]
    111929737 (HSPA2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccae04147]
    111929737 (HSPA2)
Protein phosphatases and associated proteins [BR:ccae01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     111929737 (HSPA2)
Spliceosome [BR:ccae03041]
 Complex B
  Other components
   Prp19 complex
    111929737 (HSPA2)
 Complex C
   Prp19-CDC5 complex
    111929737 (HSPA2)
Ribosome biogenesis [BR:ccae03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    111929737 (HSPA2)
Chaperones and folding catalysts [BR:ccae03110]
 Heat shock proteins
  HSP70 / DNAK
   111929737 (HSPA2)
Membrane trafficking [BR:ccae04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    111929737 (HSPA2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    111929737 (HSPA2)
Proteasome [BR:ccae03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    111929737 (HSPA2)
Mitochondrial biogenesis [BR:ccae03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    111929737 (HSPA2)
Exosome [BR:ccae04147]
 Exosomal proteins
  Proteins found in most exosomes
   111929737 (HSPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl CRIC_ras_sig FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 111929737
NCBI-ProteinID: XP_023783175
Position
5
AA seq 634 aa AA seqDB search
MSAKGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPTNTIFDAKRLIGRKYDDPTVQSDMKHWPFRVVNESGKPKVQVEYKGEMKTFFPEEI
SSMVLTKMKEIAEAYLGCKVQNAVITVPAYFNDSQRQATKDAGTITGLNVMRIINEPTAA
AIAYGLDKKGTRAGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VNHFVEEFKRKHKRDIAGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVTPLSLGIETAGGVMTALIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTRDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVSAVDKSTGKENKITITNDKGRLSKDDIDRMVQEAEKYKAEDEANRDRVA
AKNSLESYTYNMKQTVEDDKLKGKISDQDKQRVLDKCKEVVSWLDRNQMAEKEEYEHKQK
ELEKLCNPIVTKLYRGDGGAGAGGSGGPTIEEVD
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaaagggccggcgatcggcatcgacctgggcaccacgtactcctgcgtgggt
gttttccagcacggcaaagtggagatcatcgccaacgaccagggtaaccgcaccacaccc
agctatgtggcgttcaccgatacagagcgcctcatcggggatgctgctaagaaccaggta
gcgatgaaccccaccaacaccatctttgacgccaagcgcctcatcggtcgcaagtatgac
gaccccacggtgcagtcggacatgaagcattggcctttccgtgtggtgaacgagagcggc
aagcccaaggtgcaggtggagtacaagggggagatgaagaccttcttcccagaggagatc
agctccatggtgctcaccaagatgaaggagattgctgaggcctatctagggtgcaaggtg
cagaacgctgtcatcacagtgccggcgtacttcaatgattcccagcgccaggccaccaag
gatgccggcaccatcactggcctcaatgtgatgcgtatcatcaatgagcccactgcagct
gctattgcttatggcctggacaagaaaggaacccgggctggagagaagaatgtgctcatc
tttgacctgggagggggcactttcgatgtctcaatccttaccatcgaggatgggattttt
gaggtaaagtccacggccggtgacacccatttgggtggagaggactttgacaaccgcatg
gtgaaccattttgtggaagaattcaagcgtaagcacaagcgtgacatcgctggcaacaag
cgagcggtgaggcggctgcgcacggcttgtgagagagcgaagcggaccctcagctcctcc
acgcaggccagcattgagattgactctctctttgagggtattgacttctacacctccatt
actcgtgcccgttttgaggagctcaatgctgacctcttccgtggcaccctggagccggtg
gagaaggctttgcgtgatgccaagctcgacaagggccagatccaggagatcgtgctggtg
ggtggctctacccggatccccaagatccagaagctgctacaggatttcttcaatggtaaa
gagctcaacaagagcatcaaccctgatgaggctgtggcttatggcgctgctgtacaagca
gctattctcatgggagacaagtctgagaacgtgcaggatctgctgctgttggatgtcacc
cctctgtccctgggcatcgagacggctggaggagtgatgaccgctctcatcaagcgcaac
accaccatccccaccaaacaaactcagaccttcaccacctactcagacaaccagagcagc
gtcctggtccaggtgtatgagggtgagagggctatgacaagggataacaatttgctgggc
aagtttgacctaacaggcatccccccagcgcccaggggagtcccccagatcgaggtcact
tttgacatcgatgccaatggtatcctgaacgtcagtgccgtggacaagagcacgggtaag
gagaacaagatcaccatcaccaacgacaagggtcgcctcagcaaggacgacattgaccgt
atggtgcaagaagcagagaagtacaaagcagaggatgaagctaaccgggatcgggtggca
gccaagaactccctcgagtcctacacttacaacatgaagcagacagtggaggacgataaa
ctgaagggaaagatcagtgaccaggacaagcagagagtgctcgacaagtgcaaggaggtg
gtttcttggctcgaccgcaaccagatggctgagaaggaagagtacgagcacaagcagaaa
gagctggagaaactctgcaacccgatcgtcacaaaattgtaccggggagatggaggggcc
ggggcgggtggctccggcggccccaccatcgaagaagtagattaa

DBGET integrated database retrieval system