KEGG   Cyanistes caeruleus (blue tit): 111930079Help
Entry
111930079         CDS       T05602                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00564  Glycerophospholipid metabolism
ccae00565  Ether lipid metabolism
ccae00590  Arachidonic acid metabolism
ccae00591  Linoleic acid metabolism
ccae00592  alpha-Linolenic acid metabolism
ccae01100  Metabolic pathways
ccae04010  MAPK signaling pathway
ccae04217  Necroptosis
ccae04270  Vascular smooth muscle contraction
ccae04370  VEGF signaling pathway
ccae04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111930079
   00565 Ether lipid metabolism
    111930079
   00590 Arachidonic acid metabolism
    111930079
   00591 Linoleic acid metabolism
    111930079
   00592 alpha-Linolenic acid metabolism
    111930079
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111930079
   04370 VEGF signaling pathway
    111930079
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111930079
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111930079
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111930079
Enzymes [BR:ccae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     111930079
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2
Motif
Other DBs
NCBI-GeneID: 111930079
NCBI-ProteinID: XP_023783685
Position
5
AA seq 779 aa AA seqDB search
MGSNLSTSETFTSTSAPAVRTAPVSPFNLLTVKILRVRNARKADLLTLSDCYVTLWLPNV
LELKVCDEDTITRDDELCTVLFDIDKLTVGRTVRVKFQLNPQAREELEVEFTLQNTLDYP
DGIITNGVLVAREVSCLEVRVDTGKLKQQSTNPELTFTVKGSHEGSQKILLDSGPSLHII
IFHCIINDQTKLDILLPEELADGNETEKSGVLSFPLNSLPLQKEITLEEDNSFHLCLTAR
KCSGDLDVRLGFSLCMEEQDFLRKRKKYVAAALKKILNLEEDLKEHEVPVVAITTTGGGT
RSLTAMYGSLLGLQKLNLLDCISYIGGLSGTTWTMANLYEDANWSQKYLEDAIKEARKQV
TKSKICCFSLDCLKYYYNDLMERTKEGHNTSFIDLWGLVIESINQNQKDEHRLSDQRQAV
DKGQNPLPIYVAINLKSNYSAQAFREWLEFTPYEVGLLKYGASIRAEHFGSQFFMGRMVK
KLSETRICYMQGMWSSIFSIDVMYVWNLAADSEDFWCRWTRDRVKDIAEDPFLSVNPYEV
DTCLFTPSSVFSSTLRDVLTGRPTIAQYPNFIRGFQLHNKYLESEGFSTWKDTVIDSFPN
KLMETADSELSLVDTGFFINTSYPPLLRSKREVDVILHLNYSGGSQTLPLDQIGKYFSEQ
EIPFPKIEISEEDRENLKECYVFEEADSPQAPTVLFFPLVNDTFKKYKAPGVERSPEEMA
EGKVDVSTILSPFTTREVCFSEENFDKLVKLTDYNVLNNEKLIIQALRLAVARRKQRNY
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgggatcaaatttaagtacaagtgagacttttacgagcacctcagcaccagcggtgaga
acggcaccagtatctcctttcaacttgctcactgtaaaaatactgagagtgaggaatgcc
cggaaggcagacttgctcacactttcagattgctacgtgacgctgtggctgcctaacgtg
ctggagctgaaggtctgtgatgaagacacgatcaccagggatgatgaactctgcacagtt
ctctttgacatagataaactcactgtaggacgtactgtccgtgtgaagttccagctgaac
ccacaggcacgtgaggagctggaggtggagtttacattgcagaacactctggactaccct
gatggcattattacaaatggagtactagtggcacgtgaggtttcctgtttggaggttaga
gtggatacagggaagctgaagcagcaatccacaaatccagagcttacatttacagtgaaa
ggatcccatgaaggaagccagaagatattgctggactctggccccagccttcatataatc
atattccactgcatcataaatgaccagacaaaactagatatcctattaccagaagagctg
gctgatggaaatgaaacagagaaatctggggtcctttctttccccctgaattcactccct
ctgcagaaggaaataacactagaagaggataattcatttcacttgtgcttgacggctaga
aaatgctcaggagacctggatgtgcgcttggggttcagcctgtgcatggaagagcaggac
ttcctgcggaaaaggaagaaatatgttgctgctgctctgaaaaagattcttaatttggag
gaggatctgaaagagcatgaggtgccagtggtggccattacgacaaccgggggaggaacg
aggtcgctcacagcgatgtacggcagcctgctgggcctccagaaactcaacctgttagac
tgcatttcctacatcgggggtttatcgggtaccacatggaccatggcaaacttatatgaa
gatgctaattggtcacaaaaatatctggaggatgcaatcaaggaagctcgcaagcaagta
accaaatccaagatttgctgtttttctttggattgtctgaagtactattataatgacctg
atggagaggactaaagaaggccataacacttccttcatagacctttggggtcttgtcatt
gagtccattaatcaaaaccagaaagatgagcacagactctcagaccaacgtcaggcagtg
gataagggccagaacccactgcccatctatgtggccatcaacctcaagtccaactatagt
gcccaggcattcagagagtggctggaattcactccctatgaagttggcctgctgaaatat
ggagcgtctattcgcgcagaacactttggaagtcaattttttatgggaaggatggtgaag
aagctctcagagactcggatctgctatatgcaaggcatgtggagtagtatattttccata
gatgtgatgtatgtctggaatttggctgctgattcagaagatttctggtgcagatggacc
agagacagagtaaaggatattgcagaagacccctttctgtctgtgaatccctatgaagta
gacacgtgtctgttcactccctcgagtgtcttctcctctactctgcgagatgtcttaaca
ggacgtccaaccattgcacagtatcccaattttatcagaggcttccagctgcataacaag
tacctggagagtgaaggattttctacctggaaagacacagtgatagactccttcccaaat
aaactgatggaaacagcagacagtgagctgtccctggttgatactggctttttcattaat
accagctacccaccacttttgagatcaaagagggaggttgacgtcatcctgcatttgaat
tacagtggagggtcacaaacactgcctctggatcagattgggaagtacttctcagagcaa
gaaattccatttcccaaaattgagataagtgaggaagacagggaaaacttaaaggagtgc
tatgtgtttgaagaggctgacagcccacaagctccaacagtgcttttttttcccctagta
aatgacaccttcaagaaatacaaagctcctggtgtggaaaggagtcctgaagagatggct
gaaggcaaagttgatgtctccaccatcctctccccatttacaacaagagaggtgtgtttc
agtgaagagaattttgacaaactggtgaaactgactgattacaatgtcctgaacaacgag
aagttgattattcaggccttgcgcttggcggtggcacggaggaagcagaggaattattag

DBGET integrated database retrieval system