KEGG   Cyanistes caeruleus (blue tit): 111931361Help
Entry
111931361         CDS       T05602                                 

Gene name
EIF3A
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    111931361 (EIF3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ccae03012]
    111931361 (EIF3A)
Translation factors [BR:ccae03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    111931361 (EIF3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 111931361
NCBI-ProteinID: XP_023785713
Position
6
AA seq 1339 aa AA seqDB search
MKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYL
KLAEEKTEAAKEESQQMVLDIEDLDNIQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLW
ESYRQCLDLLRNNSRVERLYHDIAQQAFKFCLQYTRKAEFRKLCDNLRMHLGQIQRHHNQ
STAINLNNPDSQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFALSKKPPKPQLMAN
YYHKVSTVFWKSGNALFHASTLHRLYHLSREMRKNLTQEEMQRMSTRVLLATLSIPITPE
RTDIARLLDMDGIIVEKQRRLATLLGLQAPPTRASLINDMVRFNVVQYVVPEVKELYNWL
EVDFHPLKLSARVSKVLNWVKDQAEKEPELQLYIPHLQNNTILRLLQQVAQIYQSIEFAR
LCTLVPFVDAFQLERCIVDAARHCDLQVRLDHTTRTLSFGSDLNYCTREDAPLGPQLQSM
PSEQIRNQLTAMSSALAKALAVIKPPHLMQEKEEQHQLAVTAFLKNSRKEHQRILARRQT
IEERKERLESLNIQREKEELEQREAELQKVRKAEEERLRQEAKEREKERILQEHEQIKKK
TVRERLEQIKKTELGAKAFKDIDIEDLEELDPDFIMAKQVEQLEKEKKELQERLKNQEKK
IDYFERAKRLEEIPLIKTAYEEQRVRDMELWEQQEEERITTLQLEREKALEHKSRLSRML
EDRDLFEARLKASRRTVYEDKLKQFQERLAEERRNRLEERKKQRKEERRITYYREKEEEE
QRLREEQLLKEREEKERIEREKREQEQREYQERVKKLEELEKKKRQREMEIEERERRREE
ERRGLDDPFSRKESRWGDRESESSWRRGGEPESEWRRAPVERDWRRGDPRDDERPFRRGD
DLPRRGDDLPRRAPADEKERPPESAEDRPPRREGDEDRPPRREGEEDRPPRRGLDEDRPP
RRGLDDDRGSWRAADDDRGPRRALDDDRPPRRALDDDRPPRRALDDDRPPRRALDDDRPP
RRALDDDRPPRRGLDDDRGSWRAADDDRGPRRGLDDDRPPRRALDDDRPPRRGLDDDRGS
WRAADDDRGPRRGLDDDRGPRRDDDRGPWRNADDDRLSRRDDDRGPWRGSEDSRPGPWRP
FGKPGGWREREKAREDSWGPPRDSRPSADREWDRDKDRDENEKEREFDRERDFDRDDRFR
RPRDDGGWRRGPAEETSSWRDSSRREEWDRGGRDMRDRRGDDREPPLRRGPPLRSEREEP
SSWRRADDRREERGEEREPVRRSAPAPAAPPASAPSAASKERERDGEKEKGSWKTEKERE
PVRRTKNETDEEGWTTVRR
NT seq 4020 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtaaaaaacaccgaacatggcagaaaatccacgagccaattatgctgaagtac
ttggaactctgcgtggatctgcgcaagagtcacctggcaaaagaaggactgtaccagtac
aagaatatttgccagcaggttaacatcaaatctttggaggatgttgttcgagcctattta
aaattagctgaagaaaaaacagaagcagctaaggaagaatcccagcagatggtactggac
atagaagacttggataacattcagactccagaaagcgttcttttgagtgctgtaagtgga
gaagacactcaggatcgtactgaccgcctgcttttgacaccctgggttaaatttttgtgg
gaatcctacagacagtgtttggatcttctccgaaataattctcgagtagaacgcctgtac
catgacattgcacagcaagctttcaagttctgcctgcagtacacgcggaaagcagagttc
cgcaagctctgcgataacctgcggatgcacctggggcagatccagcggcaccacaaccaa
agcacagccatcaacctcaacaaccctgacagccagtccatgcacctggagactaggctg
gtgcagctggacagtgctatcagcatggagctgtggcaggaagctttcaaagcagtggaa
gatattcatggactatttgcactgtctaagaagccccccaaaccacagctgatggcaaat
tactatcacaaagtttcaactgtcttctggaaatcaggaaatgctctttttcacgcatcc
acccttcaccgactttatcacttatcaagagaaatgcgaaagaatctcacacaagaggag
atgcagaggatgtccactcgagtccttttggccaccctgtccattccaataactccagag
agaactgatattgctcgtctcctggatatggatggaatcattgtggagaaacagcggcgc
ctggccaccctgctggggctgcaggccccccctacacgggccagcctcatcaatgacatg
gtcaggttcaatgtagtgcaatatgtagtcccagaagtgaaagaactttacaattggctt
gaagtagactttcacccgctcaagttgagtgcccgtgtcagcaaggttctgaactgggtg
aaggaccaagctgaaaaggaacctgaactgcagctgtacattcctcacctgcaaaacaac
accattcttcgccttctgcagcaggtggcccagatttatcaaagcattgagtttgctcgt
ctgtgtaccctggttccttttgtggatgctttccagctggagcgttgtatcgtggatgca
gccaggcattgtgacttacaggttcgccttgaccacacaaccaggacactgagttttggt
tcagatttgaattactgtactagagaggatgctccactgggccctcagctgcagagcatg
ccttctgagcagatcagaaaccaactgactgccatgtcctcagctctggctaaggcactt
gcagttattaagcctcctcacttaatgcaagagaaggaagaacaacatcaactggcagtc
accgccttcctgaaaaattccaggaaggagcatcagcgtatccttgcgcgccgtcagacc
atagaggagagaaaggagcgcctggaaagtttgaacatccagcgtgaaaaggaggagctg
gaacaacgggaagcagaattgcaaaaagtccggaaagccgaggaagagaggctgcgccag
gaggcaaaggagagggagaaggagcggatcctgcaggagcatgagcagatcaaaaagaaa
actgttcgggagcgtttggagcagattaagaagactgaactgggagccaaagcgtttaaa
gatattgatattgaggatcttgaagagttggatcctgactttattatggctaaacaagtg
gaacagctggaaaaagaaaagaaggaacttcaggagcgactgaagaatcaggagaaaaag
attgactacttcgaaagagcgaagcgcttggaagaaattcctttaataaagactgcctat
gaggagcaaagagtgcgtgatatggagctgtgggagcaacaggaagaagaaaggatcacc
accctgcagctggagcgtgagaaagcccttgagcacaagagcagactctccaggatgttg
gaggatagagatttatttgaagccaggctgaaagcatcacgacgaacagtttacgaggat
aaactcaagcagttccaggagcggttggcagaggagaggcggaaccgtctggaggagcgc
aagaagcagcgcaaagaggagaggcgcatcacttactacagggagaaggaagaggaggag
caaaggctacgggaagagcagctgcttaaagagcgtgaggagaaggagcgcatcgagcgc
gagaaacgcgagcaggagcagcgggagtaccaggagagagtcaaaaaactggaggaactg
gagaagaaaaaacgtcaaagagaaatggagatagaggaaagagagcgccgccgggaagag
gaaaggagaggtctggatgacccattttcaaggaaggagtctcgttggggtgacagggag
tccgaaagctcctggagaagaggtggtgagccagaatcagaatggcgtcgagcaccagtg
gagagagactggcgtcgaggagatccaagagacgatgagagacctttccgacgtggggat
gatctgcctcggcgaggggatgatctgcccaggcgtgctcctgcagatgagaaggagcgt
cctccagaatcagcagaggacaggccacctaggcgggaaggggacgaggacaggcctccg
aggcgagaaggggaagaggacaggccccccagacgtggcttggatgaggacaggccaccc
cggcgtggtttggatgatgacagaggaagctggcgagctgcagatgatgacaggggtccc
agacgtgccctggatgatgacaggccccccagacgtgccctggatgatgacagaccaccc
agacgtgccctggatgatgacaggccccccagacgtgccctggatgatgacagaccaccc
agacgcgccctggatgacgacaggcccccccggcgcggcttggacgacgacagaggcagc
tggcgcgcggcggatgacgacagagggccccggcgcgggctggacgacgaccggccgccc
cgccgggctctggatgatgacaggccccccaggcgcgggctggatgacgacaggggcagc
tggcgcgctgcagatgatgacagggggccccggcgtgggctggatgacgacagagggccc
cggcgggatgacgacaggggaccctggcggaacgcggacgatgacaggctttccagaaga
gatgatgacaggggcccgtggcgtggaagtgaagactcaaggccaggtccttggagacca
tttggtaaaccaggggggtggagagaacgagagaaggctcgtgaggacagctggggccct
ccccgagactccagaccttcagcagaccgtgaatgggatcgagacaaagatcgggatgaa
aatgagaaggagcgggaattcgacagggagagagattttgatcgagacgatcgtttcagg
cgtcccagggatgacggtggttggaggagagggccagctgaggaaacttcgagctggaga
gattcaagtcgtcgtgaggagtgggacagaggtggtcgtgacatgagagaccgacgtggt
gatgacagggagccgcccctcaggagaggaccacccctccgatccgagcgggaagagccg
agctcgtggcgacgcgctgacgacaggagggaagagcgcggggaggaacgggaaccggtg
cggcggtcagcccctgctcctgctgctcctccagcttctgctccctcagcagcttccaaa
gagcgggaaagggatggggaaaaggagaaaggatcctggaaaacagagaaggagcgtgag
cccgtacgccgcactaaaaacgagacagatgaagaagggtggaccaccgtacgacgttaa

DBGET integrated database retrieval system