KEGG   Cyanistes caeruleus (blue tit): 111931442Help
Entry
111931442         CDS       T05602                                 

Gene name
TSPAN12
Definition
(RefSeq) tetraspanin-12 isoform X1
  KO
K17355  tetraspanin-12
Organism
ccae  Cyanistes caeruleus (blue tit)
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    111931442 (TSPAN12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin SUR7
Motif
Other DBs
NCBI-GeneID: 111931442
NCBI-ProteinID: XP_023785834
Position
1
AA seq 282 aa AA seqDB search
MSITILGVSAWLRDYLNNVLTLTAETRVEEAVILTYFPVVHPVMIAVCCFLIIVGMLGYC
GTVKRNLLLLVWYFGSLLVIFCVELACGVWTYEQEITVPVQWSDMITLKARMTNYGLPRY
QWLTHAWNFFQREFKCCGVVYFTDWLEMTELDWPPDSCCVKEFPGCSKQAHHEDLSDLYQ
EGCGKKMYTFLRGTKQLQVLRFLGISIGVTQILAMILTITLLWALYYDRRDPRADQIMAL
KSDTSQELSCHSMELLKPSLTRIFEHTSMANSFNTHFEMEEL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcaccatattaggtgtttctgcttggctgagagactacctgaataatgttctc
actttaactgcagaaacaagggtggaggaggctgtcattttgacttactttcctgtggtc
cacccagttatgattgcagtctgctgtttcctcatcatagttggaatgctgggatactgt
ggaacagtgaaaagaaatctgttgctccttgtctggtattttggaagcttgcttgtaata
ttctgcgttgaactggcctgtggtgtttggacctacgagcaggaaataacggttccagtg
cagtggtctgatatgatcacactgaaagccaggatgaccaattatggactgcctaggtac
cagtggctgacccatgcttggaatttcttccagagggagtttaaatgttgtggcgtggtg
tacttcacagactggctggaaatgacagaattggactggccacctgactcctgttgtgtc
aaagagttcccaggatgctctaagcaggcacatcatgaggatctcagtgacctttatcag
gagggatgcggtaaaaaaatgtacacttttttgagggggacgaagcaattgcaagtgctg
agatttctaggaatctctattggagtaacacagatcctggctatgatcctcactattact
ttgctgtgggctctgtactatgacagaagggatcccagagcagatcagatcatggcactg
aagagtgatacctcgcaggagctgtcatgtcattccatggagctactgaaaccaagcctg
accaggatctttgaacatacatccatggcaaacagctttaatacacactttgaaatggaa
gagctataa

DBGET integrated database retrieval system