KEGG   Cyanistes caeruleus (blue tit): 111931623Help
Entry
111931623         CDS       T05602                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00010  Glycolysis / Gluconeogenesis
ccae00562  Inositol phosphate metabolism
ccae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111931623 (MINPP1)
   00562 Inositol phosphate metabolism
    111931623 (MINPP1)
Enzymes [BR:ccae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     111931623 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     111931623 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708 Methyltrn_RNA_4
Motif
Other DBs
NCBI-GeneID: 111931623
NCBI-ProteinID: XP_023786089
Position
6
AA seq 227 aa AA seqDB search
RRLALASSSKHRCLQSGAAFRRGLGPTLDFGGDEVEVEVNDSLMRFFDHCAKFVALVEEN
DTAMCQVNAFKEGPEMKKVREKVASALCLPVEELNADLVQVAFLTCSYELAIKNVTSPWC
SLFSEEDAKVLEYLNDLKQYWKRGYGYDINSRSSCILFQDIFQHLDKAVEESKSSKPISS
PLIVQVGHAETLQPLLALMAAGTAPPGPLLTGPFQPLCPSLELQGLG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
cgccgcctggcgctggccagcagctccaagcaccgctgcctgcagagcggggcggccttc
cgccgcggcctcgggcccaccctcgacttcggcggcgacgaggtggaggttgaagttaac
gactccctgatgcggttctttgatcactgtgccaagtttgtagccctggtggaggagaat
gacacggccatgtgccaggtgaatgccttcaaagaggggcccgagatgaagaaggtccgg
gagaaggtggccagtgccttgtgtttgccggtggaggagctaaatgcagatcttgttcaa
gtggctttcctcacctgctcatatgagctagccataaaaaatgtgacctccccgtggtgt
tctctcttcagtgaagaagatgctaaggtgctggaatacctgaatgacctgaagcaatac
tggaaaagaggatatggctatgacatcaacagtcgttccagctgcatcttattccaagat
atcttccagcacttggacaaagcagtggaagagagcaaaagctccaaacccatttcttca
cctttgattgtccaagttgggcatgcagagaccctccagcccctgcttgccctgatggcc
gctggcacagcacccccagggcctctcctgacgggccctttccagcccctctgccccagc
ctggagctgcagggcttggggtga

DBGET integrated database retrieval system