KEGG   Cyanistes caeruleus (blue tit): 111932669Help
Entry
111932669         CDS       T05602                                 

Gene name
FASLG
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04010  MAPK signaling pathway
ccae04060  Cytokine-cytokine receptor interaction
ccae04068  FoxO signaling pathway
ccae04210  Apoptosis
ccae04217  Necroptosis
ccae05164  Influenza A
ccae05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111932669 (FASLG)
   04068 FoxO signaling pathway
    111932669 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111932669 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111932669 (FASLG)
   04217 Necroptosis
    111932669 (FASLG)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    111932669 (FASLG)
   05168 Herpes simplex virus 1 infection
    111932669 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccae04147]
    111932669 (FASLG)
   04052 Cytokines and growth factors [BR:ccae04052]
    111932669 (FASLG)
   04090 CD molecules [BR:ccae04090]
    111932669 (FASLG)
Exosome [BR:ccae04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   111932669 (FASLG)
Cytokines and growth factors [BR:ccae04052]
 Cytokines
  Tumor necrosis fators
   111932669 (FASLG)
CD molecules [BR:ccae04090]
 Proteins
  111932669 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF PepSY_TM
Motif
Other DBs
NCBI-GeneID: 111932669
NCBI-ProteinID: XP_023787595
Position
8
AA seq 280 aa AA seqDB search
MQPYRGRAAPGVGAAPSPAAFGYHKDDPSRHVPPIPNPNCYPQIFWVEGCADASAPPGAP
FPPPVPDRRRKPRNDGERRSAGFLVMFLLILVAFTGVGLSIFKIFHLEKEVDELRESASA
EHIPPASQKLTGQKEQPVQKEARRAAHLTGNPAQQDLPLEWEPISGHAYTSGIQYQQRGL
VVSEPGLYFVYSKVLFRGSACDSQLLSHVVYKRNPSSPGSLVLMEDKATNFCTGKRMWAR
NSYLGALFKLRKMDSLHVNVSKIALVNFEESKTFFGLFKL
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgtaccggggcagagctgcccccggggttggggctgcgccgagcccggcagct
ttcgggtaccacaaggatgatcccagcaggcacgtcccgcccatccccaacccgaactgc
tacccgcagatcttttgggtggaaggctgtgctgatgcttcggctccccccggggctccc
ttcccaccgccggtacccgaccggaggaggaagccacggaacgacggggaaaggaggagc
gccggcttcctcgtgatgttcctgctgatcctggtggccttcaccggagtggggctgagc
atatttaagatttttcacctggagaaggaagtggatgaactcagagagtctgccagcgct
gagcacatccctccagcctcccagaaactcacggggcagaaggagcagcctgtgcagaag
gaggcgaggagggcggcacatctgacaggcaacccagcccagcaggacctccctctggag
tgggagcccatctctggccatgcctacaccagcggcatccagtaccagcagcgggggctg
gtggtgagcgagcccgggctgtacttcgtgtactccaaggtgctgttccgcggcagcgcc
tgcgacagccagctcctgtcccacgtcgtctacaagaggaatccatcctctcccggcagc
ctggtgctcatggaggacaaagccaccaatttctgcacggggaagaggatgtgggcccgc
aacagctacctgggggctctcttcaagctcaggaagatggacagtctgcacgtcaacgtc
tccaaaatcgccctggttaattttgaggaatccaagactttctttggtttgtttaagctt
tga

DBGET integrated database retrieval system