KEGG   Cyanistes caeruleus (blue tit): 111932887Help
Entry
111932887         CDS       T05602                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis protein 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ccae  Cyanistes caeruleus (blue tit)
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccae04131]
    111932887 (DOCK7)
Membrane trafficking [BR:ccae04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    111932887 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N TEA
Motif
Other DBs
NCBI-GeneID: 111932887
NCBI-ProteinID: XP_023787958
Position
8
AA seq 2161 aa AA seqDB search
PDGSKQSLVSFQQHRQVCVIHPLSEITLSLCRCRTVAAEVRKQISGQYGGSPQLLKNLNI
GGSVSHHTSVPLTEAVDPVDLEDYLITHPLAVESGPLRDLLEFPPDDIEVVYTPRECRTL
VSAVPEESEMDPHVRDCVRSYTEDWAIVNRKYHKLGTGFNPNTLDKQKERQKGLPKQIFE
SDEAPDGNSYQDEQDDLKRRSMSIDDTPRGSWACSIFDLKNSLPDALLPNLLDRTPNEEI
DHHNEDQRKSSRHKELFALHPAPDEEEPIERLSVPEVPKEHFGQRLLVKCLSLKFEIEIE
PIFASLALYDVKEKKKISENFYFDLNSEQMKGMLRPHVPPAAISTLARSAIFSITYPSQD
VFLVIKLEKVLQQGDIGECAEPYMIFKESDAAKNKEKLEKLKGQAEQFCQRLGKYRMPFA
WTAIHLMNIVSSAGSLERDSTEVEVGTGERKGSWSERRNSSIVGRRSLERTTSGDEACNL
SSFRPATLTVTNFFKQEGDRLSDEDLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPEN
PHYCLTPELLQVKLYPDSRVRPTREILEFPARDVYVPNTTYRNLLYVYPQSLNFANRQGS
ARNITVKVQFMYGEDPSNAMPVIFGKSSCPEFSKEAYTAVVYHNRSPDFHEEIKIKLPAT
LTDHHHLLFTFYHVSCQQKQNTPLETPVGYTWIPMLQNGRLKTGQFCLPVSLEKPPQAYS
VLSPEVPLPGMKWVDNHKGVFNVEVVAVSSLHTQDPYLDKFFALVHALDEHMFPVRIGDM
RIMENNLENELKSSISALNSSQLEPVVRFLHLLLDKLILLVVRPPVIAGQIVNLGQASFE
AMASIINRLHKNLDGNQDQHGRNSLLASYIYYVFRLPNTYPNSPSPGPGGLGGSVHYATM
ARSAVRPASLNLNRSRSLSNSNPDISGTPTSPDDEVRSIIGTKGLDRSNSWVNTGGPKAA
PWGSNPSPSAESTQATDRSCNRMSSHTETSSFLQTLTGRLPTKKLFHEELALQWVVCSGS
VREAALQQAWFFFELMVKSMVHHLYFADKLDAPRKNRFPERFMDDVSALVSTIAGDIVSR
FQKDTEMVERLNTSLAFFLNDLLSIMDRGFVFALIKTCYKQVSSKLYSLTNPSNLASLRL
DFLRIICSHEHYVTLNLPCSLLTPPASPSPSVSSATSQSSGFSTNVQDQKIANMFELSLP
FRQQHYLAGLVLTELAVILDPDAEGLFGLHKKVINMVHNLLSSHDSDPRYADPQVKARVA
MLYLPLIGVIMETVPQLYDFTESHNQRGRPSCVAVDDYESEGGSMISQTVAMAIAGTSVP
QLTRPSSFLLPSSSGRQHSTFSTESSRSLLICLLWVLKNADESVLQKWFTDLSVLQLNRL
LDLLYLCVSCFEYKGKKVFERMNSLTFKKSKDMRAKLEEAILGSIGARQEMVRRSRGQLE
RSPSGSAFGSQENLRWRKDMTHWRQNTEKLDKSHKPARSRAEIEHEALIDGNLATEANLI
ILDTLEIVVQTVSVTESKESILGGVLKVLLHSMACNQSALYLQHCFATQRALVSKFPELL
FEEETEQCADLCLRLLRHCSSSISTIRSHASASLYLLMRQNFEIGNNFARVKMQVTMSLS
SLVGTSQNFNEEFLRRSLKTILTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEH
QEDPEMLIDLMYRIAKGYQNSPDLRLTWLQNMAGKHSERSNHAESAQCLVHSAALVAEYL
SMLEDRKYLPVGCVTFQNISSNVLEESAVSDDVVSPDEEGICSGKYFTEAGLVGLLEQAA
ASFSMAGMYEAVNEVYKVLIPIHEANRDAKKLSTIHGKLQEAFSKIVHQSTGWEDGKRMF
GTYFRVGFYGTKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVLEVIKDSNPV
DKCKLDPNKAYIQITYVEPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGDLHE
QFKRKTILTTSHAFPYIKTRINVIHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPK
MLQMVLQGSVGTTVNQGPLEVAQVFLSEIPNDPKLFRHHNKLRLCFKDFTKRCEDALRKN
KSLIGPDQKEYQRELERNYHRLKEALQPLINRKIPQLYKAVLPVTCHRDSFSRMSLRKME
I
NT seq 6486 nt NT seq  +upstreamnt  +downstreamnt
cctgatggcagcaagcagagcctggtttcattccagcagcacaggcaggtgtgtgtgatc
catcccctctcagagataaccctgtccctgtgtcgttgcaggaccgtggcagccgaggtc
aggaagcagatctcggggcagtatggaggctccccgcagctcctcaagaacctcaacatc
ggaggcagcgtctctcatcacacctctgtgcctctcacagaagccgtggaccctgtggac
ctggaggattatctcatcactcaccctctggccgtggagtcggggcccctgcgggacctg
ctggagtttccccccgatgacatcgaggtggtttacaccccccgcgagtgccggacgctc
gtgtcggccgtgcccgaggagagcgagatggacccccacgtgagggactgtgtcaggagt
tacacggaggactgggcgatcgtgaacagaaaataccacaagctgggaactgggttcaat
cccaacaccctggacaaacagaaggagaggcaaaaagggctccccaaacagatctttgag
tctgacgaagctccggatggcaacagctaccaggatgaacaagatgaccttaagcgacgc
tcaatgtcgatcgacgacactccccggggcagctgggcctgcagcatcttcgacctgaag
aactccctgcctgatgctcttctcccaaacctgctggacagaaccccaaacgaggagatt
gaccaccacaacgaggaccagaggaagtccagtaggcataaggagctttttgcactacac
ccagcaccagatgaggaggagcccatagagagactcagtgtccctgaagtacccaaagaa
cactttggccaaagactcctggtgaagtgtttgtccctgaaatttgaaatagaaattgag
cccatttttgcaagtttggctttgtatgatgttaaagaaaagaagaagatttcagagaat
ttctactttgatttaaactctgagcaaatgaagggaatgcttcggcctcatgtcccccct
gctgctatttccaccctggccagatctgccatcttttctatcacctacccatcccaagat
gtctttctagtaataaagctggaaaaagttctacagcagggagatattggggagtgtgca
gagccttatatgatttttaaagaatctgatgcagcaaagaacaaggagaagctggaaaaa
ctgaaaggccaggcagaacagttttgccaaagactcgggaagtaccggatgccttttgcc
tggacagccattcacctcatgaacattgtgagcagtgctggcagcttggaaagagattcc
acagaagttgaagttggcacaggagaacgtaaagggtcgtggtcggagaggcggaactcc
agcatcgtggggcggcgttccttggagaggaccacgagtggggacgaggcttgcaacctg
agcagcttcagaccagccaccctgacagtgaccaacttcttcaaacaggagggggatcgc
ctgagcgatgaggacctgtacaagttcctggctgacatgagacgtccctcatcggtgctg
cgcaggctcagacccatcacagctcagttgaagattgacatatctccagctccagagaac
ccccactactgcctaaccccagagctgctgcaagtcaagctttacccagacagcagagtc
agacctacaagagaaatcctggagttccctgccagggatgtctacgtcccaaacaccaca
tacaggaacctcctttatgtgtatccacagagccttaacttcgccaaccgccagggatct
gccaggaacatcacagtgaaagtgcagttcatgtatggagaggatcccagcaatgccatg
ccggtcatctttggcaaatccagctgtcctgagttttccaaagaagcatacacagctgtg
gtgtatcacaacagatctcctgattttcacgaggaaatcaagattaagcttccagccact
ttgacagaccaccaccacctgctttttactttctaccacgtcagttgccaacaaaaacaa
aacacacccctggagaccccagttggctacacctggatcccgatgcttcagaatggccgg
ttaaagacgggtcagttctgtcttcccgtgtcattggaaaagccaccacaggcttattca
gtgctttctccagaggttcctctccctgggatgaagtgggtggataaccacaaaggggtt
ttcaacgtggaagttgttgctgtgtcatccctccacactcaggacccttacctcgacaag
ttctttgcacttgtccatgctctggatgagcacatgttccctgtgcgaataggagacatg
agaattatggaaaacaacttggaaaatgaactgaagagcagcatttcagctttaaattcc
tctcaactggagccggtagtgcgatttcttcatctcctgcttgacaaactgatccttctg
gtagtaagacctcctgtcattgcaggccaaatagttaacctgggccaagcatcttttgaa
gcgatggcatcgatcataaacagacttcacaagaacttggatggcaaccaggaccagcat
ggcaggaacagccttcttgcctcctatatttattatgtttttcgcctacccaacacctat
cccaactcaccatcaccaggtcctggtggcctgggagggtcagtgcactacgccaccatg
gccaggtcggccgtgcgccccgccagcctcaacctgaaccgctcgcgcagcctcagcaac
agcaaccccgacatctccggcacccccacctcgcccgacgacgaggtgcgctccatcatc
ggcaccaagggcttagaccgctccaattcctgggtaaacactggtggtccaaaagcagcc
ccatggggatccaaccccagcccaagtgcagagtcaacacaggctacggatcgaagttgt
aatcgtatgtcttcgcacactgagacgtcaagtttcttacaaacattaacaggacgatta
ccaaccaaaaagcttttccacgaggagctggccctgcagtgggttgtgtgcagcgggagc
gtgcgagaggcggccctgcaacaggcctggttcttctttgagctgatggtgaagagcatg
gtgcatcatctgtattttgctgacaaactggatgcaccgaggaagaatcgtttcccggag
cgcttcatggatgacgtgtctgcactggtcagcacaatcgctggtgatatagtctcccgc
ttccagaaggacacggaaatggtggagcgtctcaacaccagcctggcatttttcctcaat
gatttgttgtccatcatggacagaggatttgtttttgctcttattaagacctgctacaaa
caggtgtcttcaaagctgtattccttaacaaatccaagcaacctggcatctctgaggctg
gacttcctgcgcatcatttgcagccacgagcactatgtcaccttgaatttaccctgcagc
ctgctcacaccacctgcatctccatcaccatccgtgtcttcagccacttcccagagttct
gggttctccacaaatgtccaagaccagaagattgcaaatatgtttgagttgtctttgcct
ttccgccagcagcattacctggctgggctggtgctcacagaactggctgtcattctagat
cctgatgcagaaggtttatttggattgcataagaaggtcatcaacatggtacacaacctg
ctgtccagccacgactcggacccgcggtacgctgacccccaggtaaaggcccgggtggca
atgctgtatctacctctgattggcgtgatcatggaaactgtgcctcagctctatgatttc
acagagagtcacaaccagcgggggaggccaagctgtgtcgccgtggacgattacgagagc
gagggtggcagcatgatcagccagactgtggccatggccattgcagggacttctgtcccc
cagctcaccaggcccagcagttttcttctcccttcttcgagtggcaggcagcactccacc
ttctcaacagagtccagccgcagcctcctcatctgcctgctctgggtgctgaagaacgcg
gacgagagcgtcctgcagaagtggttcactgacctgtcagtgctgcagctcaaccgcctg
ctggacctgctctatctctgtgtgtcctgctttgagtacaagggcaagaaagtgtttgaa
agaatgaacagtctgacgtttaagaagtcaaaagacatgagagccaaacttgaagaagca
attttgggcagcataggggcaaggcaggaaatggtccgaaggagtagaggacagctggag
aggagcccttctgggagtgcctttggaagtcaagagaatctgagatggagaaaggatatg
actcactggcggcagaacacagagaagcttgacaaaagccacaaaccagccaggtcaagg
gctgagatagagcatgaggccctcatcgatgggaatcttgcaacagaagccaacctgata
attttggatactctagagatagttgtacagaccgtgtccgtgacggagtctaaggagagc
atcctcggcggggtgctcaaagtgctgctgcacagcatggcctgcaaccaaagtgccctt
tacctccagcactgctttgccacacagagagctttggtctcaaagttccctgagctgctg
tttgaggaggagacagagcaatgtgcagacctgtgtctgaggctcctgaggcactgcagc
agcagcatcagcaccatcaggtcccacgccagtgcctccctgtacctcctcatgaggcag
aacttcgagattgggaacaactttgccagagtgaagatgcaggtgaccatgtccctctca
tccctggtggggacatcccagaacttcaatgaagaatttctgcggcgttccctcaagact
attctgacatatgctgaagaagatctggaacttagggagacaacatttcctgaccaggtc
caggatttagtgttcaacctccacatgatcctgtcagacacagttaaaatgaaggagcac
caggaagatccagaaatgctgattgacctgatgtacaggattgccaagggctaccagaat
tcccccgacctgcggctgacgtggctgcagaacatggcagggaaacattccgagaggagc
aaccacgccgagtccgcccagtgcctggtgcactctgcagccctggtggcagagtacctg
agcatgctggaggacaggaaatacctccctgtgggctgtgtgacatttcagaacatatct
tccaatgttttggaagagtcagcagtttctgatgatgttgtgtctccagatgaagaagga
atctgttctgggaagtattttacagaagctggtctggtgggattgctggaacaggctgca
gcatctttctccatggctggcatgtatgaagcagttaatgaggtttacaaagtccttatt
cctattcatgaagccaacagagatgccaagaagttgtctactattcatggtaaactgcag
gaagcattcagcaagattgttcaccagagtactggctgggaggatggaaagaggatgttt
ggcacctacttccgagttggtttttatggaactaagtttggagacctggatgagcaagag
tttgtttacaaggaacctgcaataaccaagctggctgaaatctcccatcggctggagggt
ttttatggagaacggtttggggaagatgtgctggaagtgatcaaggactcaaaccctgtg
gacaaatgtaaacttgatcccaacaaggcctacatccagatcacgtacgtggagccctac
ttcgacacgtacgagatgaaggacaggatcacctacttcgacaagaactacaacctgcgg
cgcttcatgtactgcacgcccttcacgctggacggccgcgcccacggcgacctgcacgag
cagttcaagcgcaagaccatcctcaccacctcccacgccttcccctacatcaaaaccagg
atcaacgtcatccacaaggaggagatcattttgacccccatcgaagtcgccatcgaggac
atgcagaagaaaacacaggaattggcttttgccacccaccaagaccctgcagaccccaag
atgctgcagatggtgctgcagggatcagtaggtaccacagtgaatcagggaccattagaa
gttgcacaagttttcttgtctgaaatccccaacgatccaaagctcttcagacaccacaac
aaactccggctctgtttcaaggacttcacaaaaaggtgtgaggatgccctgaggaagaac
aagagcctgattgggcctgaccagaaggaatatcagcgggagctggagcgcaactaccac
cggctgaaggaggctctgcagcccctgatcaacaggaagatcccacagctctacaaggca
gtgctgcctgtcacatgccacagagactccttcagcaggatgagccttcgcaaaatggaa
atctaa

DBGET integrated database retrieval system