KEGG   Cyanistes caeruleus (blue tit): 111933413Help
Entry
111933413         CDS       T05602                                 

Definition
(RefSeq) intestinal-type alkaline phosphatase-like
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00730  Thiamine metabolism
ccae00790  Folate biosynthesis
ccae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    111933413
   00790 Folate biosynthesis
    111933413
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccae04147]
    111933413
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ccae00537]
    111933413
Enzymes [BR:ccae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     111933413
Exosome [BR:ccae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111933413
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ccae00537]
 Enzymes
  111933413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase
Motif
Other DBs
NCBI-GeneID: 111933413
NCBI-ProteinID: XP_023788727
Position
9
AA seq 532 aa AA seqDB search
MAMLDPLGCTWRLPALLSPPDAEKTPGYWNRGARRRLELALALHSAAQRAKNIILFMGDG
MGVSTVSAARIYKGQLAGGSGEESVLAMETFPHVALAKTYTIDRQVPDSAGTGTAYLCGV
KANAKTLGLSGAAVYGKCHTTFGNEVDSVLHRARLAGKSVGIVTTTRVQHASPGAAYAHS
ASRSWYADANMPKEALRDGCKDIADQLIHNTDINVILGGGRMYMTPKRTPDPEYPEDPDQ
NGTRKDGRDLIAEWLSAKKGARYVWDKKGLDAVKDDSVSHLMGLFEPKDMKYELNRNTST
DPSIVEMTEKAIRILRRNPNGFFLFVEDDHIPLAGGRIDHGHHSGRAKQALMEAVMLDRA
VARAGELTSPADTLTVVTADHSHVFTFGGSTPRGNSIFGLAPKKAKDKRDYTSILYGNGP
GYSIRDGARPHPTGMTTGDKDYRQQAAVPLETETHSGEDVVVMAQGPMAHLFHGVQEQHY
IAHAMAYAACLEPYATEPGCRAARRASHGTQCSPQPLLALLALCMAALIVRG
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggccatgctggaccccttggggtgcacctggaggctcccagctctgctctcacctcca
gatgctgagaagaccccgggctactggaatagaggtgccaggagaaggctggaattggcc
ctggccttgcactcagcagcacagcgggccaaaaacatcatcctcttcatgggtgatggc
atgggggtgtccaccgtgtcagcagctcggatctacaaggggcagctggccggtggctca
ggcgaggagagcgtcttggccatggagacctttccccatgtggccctggccaagacctac
accatcgaccgccaggtgcccgacagcgctggcacgggcaccgcctacctctgtggggtg
aaggccaacgccaagactctgggactgagcggggcagccgtctatggaaaatgccacacc
acctttggcaatgaggtggactctgtcctgcaccgggccaggctggcgggcaagtctgtg
ggcatcgtgacgaccacgcgggtgcagcacgcgtcccccggggcagcctacgcgcactcg
gccagccggagctggtacgctgacgccaacatgcccaaggaggccctgcgggatggctgc
aaggacatcgccgaccagctgatacacaacactgacatcaacgtgatcctgggcggcggg
aggatgtacatgacccccaagcggactccggaccccgagtacccagaggatccggatcaa
aatggcaccaggaaggacggccgggacttgattgcagagtggctgagtgccaagaagggt
gcccgctacgtctgggacaagaagggcctggatgcggtcaaagatgactctgtgagccac
cttatgggcctctttgagcccaaggacatgaagtatgagctgaaccgcaacacatccaca
gacccctccatcgtggagatgacggaaaaggccatccgcatcctgcgcaggaaccccaat
ggcttcttcctctttgtggaagatgaccacattccccttgcaggtggcagaatcgatcat
ggccaccacagtggccgggccaagcaggcactgatggaggccgtgatgctggaccgggcg
gtggcacgggccggcgagctcacctcccccgctgacaccctgaccgtggtgacagctgat
cactcccatgtcttcacttttgggggcagcacaccacgtggcaactccatctttgggctg
gcccccaagaaagccaaggacaagcgagactacaccagcatcctctatggcaatggtcct
ggctacagcatccgtgatggggcccgtccacatcccactggcatgaccacaggagacaag
gattacagacagcaggcagctgtgcccctggagacagagactcacagtggggaagacgtg
gtggtgatggcccagggccccatggcccacctcttccacggggtgcaggagcagcactac
atcgcccatgccatggcctacgctgcctgcctcgagccctatgccacagagcctggatgc
agggcagcccgcagagcctcccatggcacacagtgctccccacagcccctgctcgccctc
ctggccctctgcatggctgcccttatagtgaggggctaa

DBGET integrated database retrieval system