KEGG   Cyanistes caeruleus (blue tit): 111935511Help
Entry
111935511         CDS       T05602                                 

Gene name
GRIA1
Definition
(RefSeq) glutamate receptor 1 isoform X1
  KO
K05197  glutamate receptor 1
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111935511 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ccae04040]
    111935511 (GRIA1)
Ion channels [BR:ccae04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   111935511 (GRIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF659 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 111935511
NCBI-ProteinID: XP_023791685
Position
13
AA seq 902 aa AA seqDB search
MQHIFAFFCTGFLGAVLGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYTFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVETSNQ
FVLQLRPELQDALISVIEHYSWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQELEKKKERLVVVDCESERLNIILNKIIKLEKNGNGYHYILANMGFMDIDL
TKFRESGANVTGFQLVNYTDTVPARIMQQWRNNDAREHPRVDWKRPKYTSALTYDGVRVM
AEAFQNLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVHFEGLSGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDEKLVPIAVDTQSGNESTSLQNRTYIVTTILEDPYV
MLKKNANQFEGNERYEGYCVELAAEIAKHVGYHYRLEIVRDGKYGARDPDTKTWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEEGRDQPATDQTNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIQTSTLPRPAAAGGSGENGRVVSHDFPKSMQTIPCMSHSTGMSLGAT
GL
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccggtttcctaggggcggtgttaggggccaat
ttccccaacaatatccagataggggggttatttcctaatcaacagtcccaggaacatgcg
gcttttaggtttgcattgtctcagctcacagaaccgcctaagctccttccccagatcgac
attgtgaacatcagtgacagctttgaaatgacatacaccttctgctcacagttctccaag
ggcgtctacgccatcttcgggttttatgagaggaggaccgtcaacatgctcacgtctttc
tgcggggccctccacgtctgcttcatcacgccgagcttccccgtggaaacctccaaccag
ttcgtcctgcagctgcggcccgagctccaggatgccctcatcagcgtcatcgagcactac
agctggcagaagtttgtgtacatttacgatgcggaccgggggctgtcagtcctgcagaaa
gtgttggacactgcagctgagaagaactggcaggtgacagctgtcaacatcctgacaaca
accgaggagggctacaggatgctcttccaggagctggagaagaagaaggaaaggctggtg
gtggtggactgcgaatctgagaggctgaacatcatccttaacaagatcatcaagcttgaa
aaaaatgggaatgggtaccactatattctggcaaatatgggattcatggacattgacctg
accaaattcagggagagtggggccaatgtcactggcttccagctggtgaattacacagac
actgttcctgccaggatcatgcaacagtggaggaataatgatgccagagagcatccacgt
gtggactggaagaggccaaagtacacgtcggcgctcacgtacgacggggtgcgggtgatg
gccgaggcgttccagaaccttcggcggcagcgcatcgacatctcccgccgtggcaacgcc
ggcgactgcctcgccaaccccgccgtgccctggggacaaggcatcgacatccagagagcc
ctgcagcaggtccattttgaaggattgtctggcaacgttcagtttaacgagaaaggacgc
aggaccaactacaccctccacgtgattgagatgaagcacgatgggatcagaaagattggt
tattggaatgaagatgagaagctggtcccaatagctgtagatactcaaagtggcaacgag
tctacgagcctgcagaacaggacctacattgtcacaactatcctggaggacccgtatgtg
atgctcaagaagaacgccaaccagtttgagggcaacgagaggtacgagggctactgcgtg
gagctggccgccgagatcgccaagcacgtgggctaccactaccggctggagatcgtgcgc
gacggcaagtacggagcgcgggaccccgacaccaaaacctggaacggcatggtgggagaa
ctcgtctacgggagggcagatgtggctgtggcaccactgaccatcaccctggttcgagaa
gaagttatagacttttccaaaccattcatgagtttaggtatatcaataatgataaaaaaa
cctcaaaagtccaaaccaggagttttttcctttctggatcctttggcctacgagatatgg
atgtgcattgtttttgcctacattggagtgagcgttgtcctcttcctggtgagtcgcttc
agcccttacgagtggcacactgaggaatttgaggagggacgggaccagccagccactgac
cagacaaatgagtttgggatattcaacagcctctggttctccctaggagctttcatgcag
caaggatgtgatatttctccaaggtctctctccggccgcatagtcggtggcgtctggtgg
ttcttcaccttgatcatcatatcctcctacacagctaacctggctgccttcctcaccgtg
gagaggatggtgtctcccatcgagagtgcagaggacttggccaagcagacagaaatcgcc
tatggcaccctggaagctggctccactaaagaattttttaggcgatccaaaatagcagtg
tttgagaagatgtggacatacatgaagtcagccgagccctccgtttttgtgaggacgacg
gaagaggggatgatccgggtgaggaagtcgaaagggaagtatgcatacctcttggagtcc
acaatgaacgagtacatcgagcagaggaagccctgcgacaccatgaaggtgggaggtaac
ttggactccaaaggctatggtattgcaacgccaaaggggtctgcactcagaggtcccgta
aacctagcggttttgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggaatgtggaagcaaggactccggaagtaaggacaagacgagcgcg
ctgagtctcagcaatgtggcgggggttttctatatcctcatcggtgggctcggactcgcc
atgctggttgccttaatcgagttttgttacaagtccagaagtgaatcaaagcggatgaag
ggtttttgtttaatcccacagcaatcaatcaacgaagccatacagacatcaacccttccc
aggccggctgcagcaggaggcagtggagaaaatggacgtgtggtcagccacgatttcccc
aaatccatgcagacgatcccatgcatgagccacagcactggcatgtccctgggagctacg
ggattataa

DBGET integrated database retrieval system