KEGG   Cyanistes caeruleus (blue tit): 111936534Help
Entry
111936534         CDS       T05602                                 

Gene name
MAPK1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04010  MAPK signaling pathway
ccae04012  ErbB signaling pathway
ccae04068  FoxO signaling pathway
ccae04114  Oocyte meiosis
ccae04140  Autophagy - animal
ccae04150  mTOR signaling pathway
ccae04210  Apoptosis
ccae04218  Cellular senescence
ccae04261  Adrenergic signaling in cardiomyocytes
ccae04270  Vascular smooth muscle contraction
ccae04350  TGF-beta signaling pathway
ccae04370  VEGF signaling pathway
ccae04371  Apelin signaling pathway
ccae04510  Focal adhesion
ccae04520  Adherens junction
ccae04540  Gap junction
ccae04620  Toll-like receptor signaling pathway
ccae04621  NOD-like receptor signaling pathway
ccae04625  C-type lectin receptor signaling pathway
ccae04810  Regulation of actin cytoskeleton
ccae04910  Insulin signaling pathway
ccae04912  GnRH signaling pathway
ccae04914  Progesterone-mediated oocyte maturation
ccae04916  Melanogenesis
ccae04933  AGE-RAGE signaling pathway in diabetic complications
ccae05132  Salmonella infection
ccae05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111936534 (MAPK1)
   04012 ErbB signaling pathway
    111936534 (MAPK1)
   04350 TGF-beta signaling pathway
    111936534 (MAPK1)
   04370 VEGF signaling pathway
    111936534 (MAPK1)
   04371 Apelin signaling pathway
    111936534 (MAPK1)
   04068 FoxO signaling pathway
    111936534 (MAPK1)
   04150 mTOR signaling pathway
    111936534 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111936534 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    111936534 (MAPK1)
   04210 Apoptosis
    111936534 (MAPK1)
   04218 Cellular senescence
    111936534 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111936534 (MAPK1)
   04520 Adherens junction
    111936534 (MAPK1)
   04540 Gap junction
    111936534 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111936534 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111936534 (MAPK1)
   04621 NOD-like receptor signaling pathway
    111936534 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    111936534 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111936534 (MAPK1)
   04912 GnRH signaling pathway
    111936534 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    111936534 (MAPK1)
   04916 Melanogenesis
    111936534 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111936534 (MAPK1)
   04270 Vascular smooth muscle contraction
    111936534 (MAPK1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111936534 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111936534 (MAPK1)
  09172 Infectious disease: viral
   05164 Influenza A
    111936534 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccae01001]
    111936534 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccae03036]
    111936534 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccae04147]
    111936534 (MAPK1)
Enzymes [BR:ccae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111936534 (MAPK1)
Protein kinases [BR:ccae01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111936534 (MAPK1)
Chromosome and associated proteins [BR:ccae03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     111936534 (MAPK1)
Exosome [BR:ccae04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111936534 (MAPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase Choline_kinase Kinase-like FTA2 Kdo
Motif
Other DBs
NCBI-GeneID: 111936534
NCBI-ProteinID: XP_023793310
Position
15
AA seq 263 aa AA seqDB search
MKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLL
NTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNR
LFPNADPKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDD
LPKEKLKELIFEETARFQPGYRS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtatatattgtgcaagatcttatggagacagatctttacaagctcttaaag
actcaacacctcagcaatgaccacatttgttatttcctttaccagattctgagagggtta
aaatatatccattcagccaatgtgcttcaccgtgacctcaaaccttcaaatttgctgctt
aacaccacatgtgatctcaagatctgtgactttggattggctcgcgttgcagatcccgat
catgatcacacaggattcctgacagagtatgtggccacacgttggtacagggctcctgaa
atcatgctgaattctaagggttacaccaagtctattgacatctggtcagtgggctgcatt
ctggcagagatgctctccaacagacccatcttcccgggaaaacactaccttgaccaactt
aaccatatccttggtatacttggatccccttcccaagaagatttgaattgtataataaat
ttaaaggccagaaactacttgctttctctaccacacaaaaataaggtaccatggaacagg
ctgtttccaaacgctgaccccaaagcacttgatttgttggataaaatgttgacctttaat
cctcataagcggattgaagtggagcaagctttagcccatccatatctggagcagtattat
gatccaagtgatgagcctgtagctgaagcacccttcaagtttgatatggagttggatgac
ttgccgaaggaaaagctgaaagaattgatttttgaggaaactgcaagattccagccagga
taccgatcttaa

DBGET integrated database retrieval system