KEGG   Cyanistes caeruleus (blue tit): 111937276Help
Entry
111937276         CDS       T05602                                 

Gene name
SPHK1
Definition
(RefSeq) LOW QUALITY PROTEIN: sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00600  Sphingolipid metabolism
ccae01100  Metabolic pathways
ccae04020  Calcium signaling pathway
ccae04370  VEGF signaling pathway
ccae04371  Apelin signaling pathway
Module
ccae_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    111937276 (SPHK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    111937276 (SPHK1)
   04371 Apelin signaling pathway
    111937276 (SPHK1)
   04020 Calcium signaling pathway
    111937276 (SPHK1)
Enzymes [BR:ccae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     111937276 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 111937276
NCBI-ProteinID: XP_023794318
Position
18
AA seq 322 aa AA seqDB search
MLAEADIATTVFVTERPHHAHEKVRDEDLSQWDTLVVMSGDGLLFEVVNGLMERPDWKEA
MKKPLCILPGGSGNALAASINYYAGYDHVAKKKLLTNCTFILCKGLYTQMDLVSLSTASG
KRFFSFLGFGWGFISDVDIDSEKYRWLGSARFTLGTLQCLAKLRVYQGRLSYLPMAAEQG
SSPAARAPXPPDSLLVPLGQPVPAHWTVVPEEEFVLVYAIYQSHLGTNLLMAPAARLHDG
CIHLFYMKAGISRVTLLKLFLAMSRGTHLDLNCPHLCYVPVRAFRLEPRVAAGIMTVDGE
ALACEPVQGQVHARLCRVLSGS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgctggctgaggcagacattgccaccactgtcttcgtcactgaaagaccccaccatgcg
cacgagaaggtgcgagatgaggacctgtcgcagtgggacacgttggtggtcatgtctggg
gacgggctgctgttcgaggtggtgaatgggctgatggaacgtccagactggaaggaggcc
atgaagaagccgctgtgcatcctgccaggaggctctgggaatgccctggctgcctctatc
aactactatgcaggctacgaccacgtcgccaagaaaaagctgctgacaaactgcaccttc
atcctgtgcaaggggctgtacacgcagatggacctggtgtcgctgagcacggcctcgggc
aagcgcttcttctccttcctgggctttggctggggcttcatctcggacgtggacatcgac
agcgagaagtaccgctggctgggcagcgcccgcttcaccctgggcaccctgcagtgcctg
gccaagctccgggtgtaccagggccgcctgtcctacctgcccatggccgcagagcagggc
agctccccggcagcccgggcccctnngccccccgactcgctgctggtgccgctgggccag
cccgtgccggcgcactggactgtggtccccgaggaggagtttgtcctggtctacgccatc
taccagtcccacctgggcaccaacctgctgatggcaccggcggcccggctgcacgacggc
tgcatccacctcttctacatgaaggccggcatcagccgcgtgacgctgctgaagctcttc
ctggccatgtccagggggacccacctggacttgaactgtccccacctgtgctacgtcccc
gtccgggcgttccgcctggagccgcgggtggccgcgggcatcatgacagtggatggggag
gctctggcctgcgagcccgtgcagggccaggtccacgcccgcctctgccgcgtcctcagc
ggctcctga

DBGET integrated database retrieval system