KEGG   Cyanistes caeruleus (blue tit): 111937573Help
Entry
111937573         CDS       T05602                                 

Gene name
GNA13
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04270  Vascular smooth muscle contraction
ccae04371  Apelin signaling pathway
ccae04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111937573 (GNA13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111937573 (GNA13)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111937573 (GNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccae04147]
    111937573 (GNA13)
   04031 GTP-binding proteins [BR:ccae04031]
    111937573 (GNA13)
Exosome [BR:ccae04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111937573 (GNA13)
  Exosomal proteins of colorectal cancer cells
   111937573 (GNA13)
GTP-binding proteins [BR:ccae04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    111937573 (GNA13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 111937573
NCBI-ProteinID: XP_023794749
Position
18
AA seq 315 aa AA seqDB search
MDGGKMHLEVHLWAGETVDAEKLLTVLFLVIAGVRVLVDAREKLHIPWGDPANQSNGDKV
MAFDTRAVTVVQGMVETGVFLDYLPAIRALWADSGIQHAYDRRREFQLGESVKYFLDNLD
KLGEQDYLPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTS
ILFLVSSSEFDQVLMEDRQTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKVQK
VSIKDYFPEFEGDPHCLTDVQKFLVDCFRTKRRDQQQKPLYHHFTTAINTENIRLVFRDV
KDTILHDNLKQLMLQ
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggatggggggaagatgcacctggaagtgcatctttgggctggtgaaacagtagatgct
gagaaactgctcacagtgctcttccttgtcattgcaggtgtgcgagtcctcgtggatgcc
agagagaaactccatatcccttggggagatcctgccaaccagagcaacggggacaaggtg
atggctttcgacacccgcgcagtcaccgtggtgcagggcatggtggagaccggtgttttt
ttggactacctgccggccatccgagccctgtgggcagacagtggcatccagcacgcgtac
gacaggcgcagggagttccagctgggggaatctgtaaagtatttcttggacaacttggat
aaacttggagaacaagattaccttccctcacagcaagacatcctgctggcacgaaggccc
accaaagggattcacgagtacgactttgaaatcaagaatgtccctttcaagatggtcgat
gtgggtggccagaggtcagaacggaagcggtggttcgagtgctttgacagtgtcacatcc
atattgttcctcgtgtcctccagcgaattcgaccaagtgctgatggaggaccggcagaca
aatcgcctgacggagtccctgaacatttttgaaacgatagtcaacaaccgtgtgttcagc
aacgtgtccatcatcctcttcttgaacaagacggacttgcttgaggaaaaagtacagaaa
gtcagcatcaaagactatttcccagagtttgaaggggatccccactgcctaacagatgtc
caaaaattcctggtggattgttttcgcacgaaacgccgggaccagcagcagaagcccctg
taccaccacttcaccactgctattaacacagagaacatccggctagttttccgtgatgtt
aaggataccatcctgcacgacaacctcaagcagctgatgttacagtga

DBGET integrated database retrieval system