KEGG   Cyanistes caeruleus (blue tit): 111937883Help
Entry
111937883         CDS       T05602                                 

Gene name
NLK
Definition
(RefSeq) serine/threonine-protein kinase NLK
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04010  MAPK signaling pathway
ccae04068  FoxO signaling pathway
ccae04310  Wnt signaling pathway
ccae04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111937883 (NLK)
   04310 Wnt signaling pathway
    111937883 (NLK)
   04068 FoxO signaling pathway
    111937883 (NLK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111937883 (NLK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccae01001]
    111937883 (NLK)
Enzymes [BR:ccae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111937883 (NLK)
Protein kinases [BR:ccae01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111937883 (NLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Pkinase_fungal APH Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 111937883
NCBI-ProteinID: XP_023795191
Position
19
AA seq 427 aa AA seqDB search
MLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAAVKAHHHQHSQHPQQQLDIEPDRP
IGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDI
LQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHR
DIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAID
IWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQ
PSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCF
STSTGRVYTSDFEPITNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLCINPQSA
AFKSFIR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacccagggcagcagcagccgtacttcccatccccggccccgggccaggcccct
ggaccggctgcagcagccccagctcaggtacaggctgcagcagctgctgcagttaaagcg
caccatcatcagcactcacaacatccacagcagcaactggacattgagccggacagaccc
atcggatatggagcctttggtgttgtctggtcagtaacagatccacgagatggaaagaga
gttgcactcaaaaagatgcccaacgtcttccaaaatttggtctcttgtaaaagggtcttc
cgggagctgaagatgttgtgtttttttaagcatgacaatgtactctctgccctcgacatc
ctccagcctccacacatcgactattttgaagaaatatatgttgtcactgagttgatgcag
agtgacctccataagattatcgtctctcctcagccactcagctcggatcatgtcaaagtt
tttctttaccagattttaagaggtctgaaatatctacattctgctggcattttacatcga
gacattaaaccagggaacctactcgtgaacagcaactgtgtccttaagatttgtgatttt
ggattggccagggtggaagagttagacgaatcccggcacatgactcaggaagttgtcact
cagtattaccgcgctccggagatcctgatgggcagccggcactacagcaatgccatcgac
atctggtctgttggctgcatctttgcagagctgcttggcagaaggatattgttccaggca
cagagtcccatccagcagctggatctgatcacagacctgctgggcacaccgtcgctggag
gcgatgaggacggcttgtgaaggcgccaaggcacacatactcaggggtcctcataaacag
ccatcccttcctgtcctgtatacactctccagtcaagctacacatgaagcagttcatctc
ctttgcaggatgttggtctttgatccatccaaaaggatatctgctaaggatgccttagct
cacccctacctggacgaggggcggttgcggtaccacacctgtatgtgcaaatgttgtttc
tccacttcgactggcagagtttataccagtgattttgaacccatcactaatcccaaattc
gatgacacttttgagaagaacctcagttctgttcggcaggttaaagaaataattcatcag
ttcattttggaacagcagaaaggaaacagagtgcctctctgcatcaaccctcagtctgct
gcttttaagagctttattaggtaa

DBGET integrated database retrieval system