KEGG   Cyanistes caeruleus (blue tit): 111939739Help
Entry
111939739         CDS       T05602                                 

Gene name
MAPKAPK2
Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04010  MAPK signaling pathway
ccae04218  Cellular senescence
ccae04370  VEGF signaling pathway
ccae04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111939739 (MAPKAPK2)
   04370 VEGF signaling pathway
    111939739 (MAPKAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111939739 (MAPKAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111939739 (MAPKAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccae01001]
    111939739 (MAPKAPK2)
Enzymes [BR:ccae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111939739 (MAPKAPK2)
Protein kinases [BR:ccae01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   111939739 (MAPKAPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Pkinase_fungal Choline_kinase
Motif
Other DBs
NCBI-GeneID: 111939739
NCBI-ProteinID: XP_023797849
Position
26
AA seq 360 aa AA seqDB search
MGMEALPERSRCAHREHPALAPVSSLVATVPAGGHDPAPRGWLGADRVSLLPQMLQDCPK
ARREVELHWRASQCAHIVRIMDVYENLYQGRKCLLIVMECLDGGELFSRIQDRGDQAFTE
REASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAVLKLTDFGFAKETTTHNSL
ATPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKKRIR
MGQYEFPNPEWSEVSEEVKQLIRNLLKTDPTQRMTITEFMNHPWIMQSMQVPQTPLHTSR
VLKEEKDLWEDVKEEMTSALATMRVDYEQIKIKKIEDSSNPLLMKRRKKANAPEPAALPH
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggggatggaggcattgccagagcgctctcgctgcgcccacagggagcacccggccctc
gctcccgtgtcctctctggtggccacggtgccagccgggggtcatgacccggctccccgg
gggtggctcggggctgacagggtgtcacttctcccacagatgcttcaggactgccccaag
gcccgcagggaagtggagctgcactggcgagcgtcgcagtgcgcgcacatcgttcgcatc
atggacgtctacgagaacctctaccaggggaggaagtgtctgctcatcgtcatggagtgc
ttggatggcggggagctcttcagcaggattcaggacaggggagaccaggccttcacagaa
cgggaggcttcagagatcatgaagagcattggggaagccatccagtacctgcactccatc
aacattgcgcaccgggacgtgaagccggaaaacctcctgtacacctccaaacggcccaac
gccgtgctgaaactcaccgacttcggcttcgccaaggaaaccaccacacacaactccctg
gccacgccgtgctacacgccctactatgtggccccagaagtgctgggcccagagaagtat
gacaagtcctgtgacatgtggtccctcggtgtcatcatgtatattctgctctgcgggtac
ccccctttctactccaaccacggcctggccatctctcctggcatgaagaagcgaatccga
atgggccagtacgagtttcccaaccctgaatggtccgaggtgtccgaggaagtgaagcag
ctgatccgcaacctgctgaaaacagacccgacccagcgcatgacaataacggagttcatg
aaccacccctggatcatgcaatccatgcaggtgccccagaccccgctgcacaccagccgt
gtgctgaaggaggagaaggacctgtgggaggatgtgaaggaggagatgaccagtgccctg
gccaccatgcgagtggactatgaacaaatcaagatcaagaaaatcgaggattcctcgaac
cctctgctgatgaagaggaggaagaaagccaacgcccccgagcccgccgcgctgccccac
tga

DBGET integrated database retrieval system