KEGG   Cyanistes caeruleus (blue tit): 111940056Help
Entry
111940056         CDS       T05602                                 

Gene name
DHX8
Definition
(RefSeq) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111940056 (DHX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ccae03041]
    111940056 (DHX8)
Enzymes [BR:ccae01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     111940056 (DHX8)
Spliceosome [BR:ccae03041]
 Complex C
  Other components
   Step II factors
    111940056 (DHX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 PRP38_assoc T2SSE AAA_19 Flavi_DEAD AAA_30 AAA_16 PhoH Sigma54_activ_2 ABC_tran Spem1
Motif
Other DBs
NCBI-GeneID: 111940056
NCBI-ProteinID: XP_023798368
Position
27
AA seq 1192 aa AA seqDB search
MAELAAAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKNTTFDTFKAILLK
NGAEFTDSLISNLLRLIQTMRPPPKPSSSKEAAVKPKSEKEKLRELYPALCRPDNPSIRN
MLDEDDVKVAADALKELEALMPSADKQGKQRSSDHRVKKRKRSRSRSRDRKRRHRSRSRS
RSRTWDRNRGKSRYRSRSRSWSPSKDRKDREKYLERSHERWRDKHIDRPPAEEPSIGDIY
NGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTG
SKTSLSMKDVDQDTGEDLNPNRRRNLVGEINEETSMRNPDRPSHLSLVSAPEVEDDSLER
KRLTRISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPF
LRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELKQAQREAEMDSIPMGLNTH
WVDPLPDVDGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQLSIIEQRESLPIF
RLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAK
RVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAH
ERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILY
TKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELI
ILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSK
TGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLAST
VLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPM
LCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAV
YNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAIC
SGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTI
DPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRRR
NT seq 3579 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctggcggcggccgaggaactcgccaagctcgagtacctgtcgctggtctcc
aaggtctgcaccgagctcgacaaccacctgggcatcaacgacaaggacctggccgagttt
gtgataagtcttgccgagaaaaataccacgtttgacacatttaaagcaattcttctgaag
aatggtgctgagttcactgattccctcattagtaacttgctacgtctcatacagacaatg
cggcctccaccaaaaccatccagcagcaaagaggcagctgtcaaacccaaatcagagaaa
gagaagttgagggagttgtatccagccctttgcaggccagacaatcccagcatcaggaat
atgctggatgaagatgatgtgaaagtggcagctgatgccctgaaagaacttgaagctctg
atgcctagtgcagacaagcagggcaagcagaggagcagtgaccatcgagtgaagaaaagg
aagaggagccgaagtcgtagcagggacaggaagcgaaggcacagatctcggtccaggtct
cgttccaggacttgggataggaacaggggaaaatccagataccggtcaaggagcagaagt
tggagtcccagtaaggaccgcaaggatcgggaaaagtaccttgagaggagccatgagagg
tggagagacaagcacatagaccgtccaccagctgaggagccttccattggagacatctac
aacggcaaagtcacgagcataatgcagtttgggtgctttgtgcagctggaaggactgagg
aaacgttgggagggtttggttcacatctcagagctgcgaagagaaggacgggttgccaac
gttgctgatgttgtgagcaaaggccaaagagtgaaagtcaaagtgttatcttttactgga
tccaaaaccagcctgagcatgaaggatgttgatcaagacactggggaagacttgaaccca
aaccgtagaaggaacctggttggagaaatcaatgaggaaacatccatgaggaacccagac
aggcccagtcacttgtccctggtgagcgcccccgaggtggaggacgacagcctggaacgg
aaacgcctcacccgcatttcagaccccgagaagtgggaaataaaacagatgattgcagct
aatgtgctttccaaggaagagtttcctgactttgatgaggagactgggattcttcctaaa
gttgatgatgaagaagatgaggatcttgagattgagctagttgaagaggagccaccattt
cttcgaggtcacaccaaacagagcatggatatgagtcccattaaaatagtaaagaatcca
gatggttccttgtcccaggctgcaatgatgcaaagtgctttagctaaagagaggcgagaa
cttaaacaagcccagagagaagcagagatggattccatccccatgggcctcaacacacac
tgggtggatcctctccctgatgtggatggaagacaaatagctgcaaacatgcgaggtatt
gggatgatgccaaatgatatcccagagtggaagaaacatgcatttggtggcaacaaagct
tcttatggtaagaagacacagctttccatcattgaacagagagaaagtctcccaatcttc
agactgaaggagcagctgatacaagctgtgcatgacaaccagattctgattgttattgga
gagacaggatctgggaaaacaacccagattacccaatacctggctgaggcaggatatacc
tcaagaggaaagattggatgtactcagcctcgcagagtggctgcaatgtctgtagcgaag
agagtgtcagaggaatttggttgctgcttgggacaagaggttggctacaccattcggttt
gaagactgcaccagccctgagactgtcatcaagtacatgacagatgggatgttactgaga
gagtgcctgatagacccagatctgacccagtatgccattatcatgctggatgaggcccat
gagaggaccatacatacagatgtgctctttgggctcctgaagaagacagtccagaaaagg
caggacatgaagttgatagtgacatcagcaacgttggatgctgtgaaattctctcagtat
ttctatgaagcaccaatcttcacaattcctggcagaacatacccggtagaaattctgtac
acaaaagagccagagacagattatttggatgccagtctgattacagtaatgcagatccat
ttaacagagccaccaggtgacattttggtctttctaactggccaggaagagattgacact
gcctgtgaaatcctctatgagaggatgaaatctctaggacctgatgttccagagttaatt
atcctaccagtatattcagctttgcccagtgaaatgcagaccaggatctttgacccagcc
ccaccagggagcagaaaggttgtcattgccaccaacattgcagagacatctttgactatt
gatggaatatattatgtggttgatcctggctttgtgaagcagaaagtctataactccaag
actggaattgaccagctggtggtgacaccaatttctcaggctcaagccaagcagcgtgca
ggaagggctgggagaacgggccctggaaaatgttacaggttatacacagaacgtgcatat
agagatgagatgttaaccaccaacgtgcctgaaatccagagaacaaatctggccagcaca
gtgctctccctgaaggctatgggcatcaacgatttgctgtcctttgactttatggatgct
ccccccatggaaactctcataactgccatggagcagctctacaccctgggagctctggat
gatgaggggctgctcactcgacttgggcgcaggatggcagaattccccttggagcctatg
ctgtgtaagatgttgatcatgtctgtgcatctggggtgcagcgaggagatgttgaccatt
gtctccatgctgtctgtacagaatgtgttctacaggccaaaggataaacaagcacttgct
gatcaaaagaaagccaagttccatcaaacagaaggtgaccacctcacgctgctggctgtg
tacaattcctggaagaataataagttttcaaatccctggtgctatgaaaattttatccag
gcccgatccttacgccgggcacaggacattcgcaagcagatgttgggcatcatggacagg
cataagctggatgtggtgtcctgtgggaaggcaacagttcgggtccagaaggccatttgc
agtggcttcttcagaaatgcagcaaagaaggatccccaggaagggtacaggacactcatt
gaccagcaagttgtctacatccacccatccagtgctctcttcaacaggcagcctgagtgg
gtggtgtatcacgagctggtgctgaccaccaaggaatacatgcgggaggtgacaaccatc
gatcctcgctggctggtggagtttgccccagctttcttcaaggtctctgatccaaccaag
ctgagcaagcagaagaagcagcagcggctggagcccctctacaaccgctacgaggagccc
aacgcctggaggatatcccgtgcgttccggcggcgatga

DBGET integrated database retrieval system