KEGG   Cyanistes caeruleus (blue tit): 111940543Help
Entry
111940543         CDS       T05602                                 

Gene name
MARS
Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00450  Selenocompound metabolism
ccae00970  Aminoacyl-tRNA biosynthesis
ccae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    111940543 (MARS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    111940543 (MARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ccae01007]
    111940543 (MARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ccae03016]
    111940543 (MARS)
Enzymes [BR:ccae01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     111940543 (MARS)
Amino acid related enzymes [BR:ccae01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   111940543 (MARS)
Transfer RNA biogenesis [BR:ccae03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    111940543 (MARS)
 Prokaryotic type
   Other AARSs
    111940543 (MARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 zf-C2HC5
Motif
Other DBs
NCBI-GeneID: 111940543
NCBI-ProteinID: XP_023799032
Position
LGE22C19W28
AA seq 504 aa AA seqDB search
MSLPPPVIPAHSWWALCIQVVLGRSLQVCTGVPWMQCHLALPYLIPELSVGSLPIPVPTP
GVCCRYCRLRNWNTLFVCGTDEYGTATETRALEEGLSPQELCDRYHAVHADVYAWFRISF
DHFGRTTTPQQTRIAQDIFQRLLARGFLLQDTLEQLRCESCGRYLADRFVEGTCPFCGYA
EARGDQCDKCGKLINAVELKNPQCKLCRGTPVVTPTQHLFLDLPKLEGQLEAWLERSWAS
GDWTANARHITRTWLRDGLKPRCITRDLTWGTPVPLDGFRDKVFYVWFDAPIGYLSITAN
YTEQWERWWKNPQQVELYNFMAKDNVPFHSVVFPCSLLGADDNYTLVNHLIATEYLNYED
GKFSKSRGVGVFGDMAKDTGIPADVWRFYLLYLRPEGQDSAFSWADLLLKNNSELLNNLG
NFINRAGMFVCKFFAGTVPDMVLTAEDQRLLARLTLEICQYHQLMEKVRIRDALRCVLSI
SRHGNQYIQVNEPWKRIKGDERDR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgcccccacctgtgatcccggcccattcctggtgggctctgtgcatccaggtg
gtcctgggccgatccctgcaggtgtgcacaggtgtcccatggatgcaatgtcacctggcc
ctgccctacctgatccctgaactctcggttggctccttgcccatcccagtgcccactcca
ggtgtgtgctgcaggtactgccggctgcggaactggaacacgctgttcgtgtgtggcacc
gatgaatacggcacggccacggagacgcgggcgctggaggaggggctgagcccgcaggag
ctctgtgaccgctaccacgccgtgcacgccgacgtctacgcctggttccgcatctccttc
gaccactttggccgcaccaccacgccccagcagaccaggattgcccaggacatcttccag
cggctgctggcgcgggggttcctgctgcaggacacgctggagcagctcaggtgtgagagc
tgtgggcggtacctggctgatcgcttcgtggagggcacctgccccttctgtggctatgcc
gaggctcgtggggaccagtgtgacaagtgtgggaagctcatcaacgccgtggagctcaag
aacccccagtgcaagctctgccgtggtaccccggtggtgacgcccacccagcacctgttc
ctggacctgcccaagctagaggggcagctggaggcctggctggagcgcagctgggcctca
ggtgactggacggccaacgcgcggcacatcacgcgcacctggctgcgggacgggctcaaa
ccgcgctgcatcacccgcgacctcacctggggcaccccagtgcccctcgacggcttccgt
gacaaggtgttctatgtgtggttcgacgctcccatcgggtacctgtccatcacagccaac
tacactgagcagtgggagcggtggtggaagaacccccagcaggtggagctctacaacttc
atggccaaggacaacgtccccttccacagcgtcgtgttcccctgctcgctgctgggcgcc
gatgacaactacaccctggtgaatcacctcatcgccacagagtacctgaactacgaggat
gggaaattctccaagagccggggtgtgggtgtgtttggggacatggccaaggacaccggg
atccctgccgacgtctggcgcttctacctgctgtacctgcggcccgagggccaggacagc
gccttctcctgggccgacctcctgctcaagaacaactcagagctgctcaacaacctgggc
aacttcatcaacagggctggcatgttcgtgtgcaagttcttcgcgggtaccgtgcccgac
atggtgctcacagctgaggaccagcggctcctggcccggctcaccttggagatctgccag
taccaccagctgatggagaaagtccgcatccgtgacgcgctcaggtgcgtgctcagcatc
tcccgccacggcaaccagtacatccaggtgaacgagccttggaagcgcatcaagggcgat
gagagggacaggtag

DBGET integrated database retrieval system