KEGG   Cyanistes caeruleus (blue tit): 111941359Help
Entry
111941359         CDS       T05602                                 

Gene name
GPX8
Definition
(RefSeq) probable glutathione peroxidase 8
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00480  Glutathione metabolism
ccae00590  Arachidonic acid metabolism
ccae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    111941359 (GPX8)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111941359 (GPX8)
Enzymes [BR:ccae01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     111941359 (GPX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 111941359
NCBI-ProteinID: XP_023800258
Position
Z
AA seq 210 aa AA seqDB search
MEPLTTSYPLKYSVPKTRVFVVFLSMLLCTTILCLLQLRFFKPKIKDFYSFEVKDSRGRI
ISLEKYRGKATLVVNVASYCQYTDKNYIALQELHREFGPSHFTVLAFPCNQFGESEPGSS
QEIESFAKGNYGVTFPVFHKIKILGSEADPAFKFLIDSSKKEPRWNFWKYLVSPEGKVVK
FWRPEEPIESIKPEVISLIRQIIMKKREDL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggagcctctcacaactagttatcctctgaagtactcagtgcccaaaaccagggtcttt
gttgtcttcctgtcaatgcttttgtgcaccaccattctctgcctgctgcaactaaggttt
tttaaacctaaaatcaaagatttttattcttttgaagtcaaggattcacgaggaaggatc
atttcattggagaaatacagaggaaaagcaactttggttgtaaacgtggccagttactgc
caatacacagacaaaaattacatcgcgctacaagaactgcacagagagtttggtccctcc
cacttcactgtgctggcgtttccctgcaaccagttcggagaatcagagcctggttcaagc
caggaaatagaatcttttgccaaaggaaactatggagtaacattccctgttttccacaaa
atcaagatcctaggatcagaagcagatcccgcctttaaatttctaatagattcttcaaag
aaagagcctcgatggaatttctggaagtaccttgtcagccctgagggcaaagttgtgaaa
ttctggagaccagaagagccaatagaaagcatcaaaccagaagtaatatcattaatcagg
cagattatcatgaagaagagagaagacctctga

DBGET integrated database retrieval system