KEGG   Cyanistes caeruleus (blue tit): 111941789Help
Entry
111941789         CDS       T05602                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase isozyme 2 isoform X1
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00010  Glycolysis / Gluconeogenesis
ccae00030  Pentose phosphate pathway
ccae00051  Fructose and mannose metabolism
ccae01100  Metabolic pathways
ccae01200  Carbon metabolism
ccae04910  Insulin signaling pathway
Module
ccae_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111941789
   00030 Pentose phosphate pathway
    111941789
   00051 Fructose and mannose metabolism
    111941789
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111941789
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccae04147]
    111941789
Enzymes [BR:ccae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     111941789
Exosome [BR:ccae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111941789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase Inositol_P SRAP
Motif
Other DBs
NCBI-GeneID: 111941789
NCBI-ProteinID: XP_023800760
Position
Z
AA seq 348 aa AA seqDB search
MWVKGPLWSSGQPVAEDIADACCTFCFLKTAARCLMGCWGRLALTTWAVGSASGLENIHT
GAKGPRFGIAGTVNVTGDEVKKLDVLSNSLVINMLQSSYSTCVLVTEENKEAIITPKDKR
GKYVVCFDPLDGSSNIDCLAPIGTIFAIYKKDTDDEPSEKDALQPGRNIVAAGYALYGSA
TLVALSTGQGVDCFMLDPGLGEFILVDKDVKIKKKGKVYSLNEGYAKYFDPAMTEYLQRK
KFPEDGSSPYGARYVGSMVADVHRTLMYGGIFMYPANQKSPKGKLRLLYECNPMAFIIEQ
AGGMATTGTKAVLDVKPENIHQRVPLILGSPDDVQEYLDCVQKHQKSS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtgggttaaagggccgttgtggagctctgggcagccagtggcagaagatattgcagat
gcttgctgcactttctgcttcctcaaaactgcagccaggtgcctcatgggctgctgggga
agactggcacttaccacctgggctgtaggctctgcctctggcctggagaacatccacaca
ggagcaaaaggacccaggtttggtattgctggcactgtgaatgtgacgggtgatgaggtg
aagaagctggatgtcttatccaactccctggtgattaacatgctccagtcctcctacagc
acctgcgtcctggtcacagaggagaacaaagaggccatcatcaccccgaaagacaagcgg
ggtaaatatgtggtgtgctttgacccccttgatggttcatccaatatagactgcttggca
ccaataggaacaatatttgccatctacaaaaaggatacagatgacgagccctctgaaaaa
gatgctttgcagcctggacgcaatattgttgctgcaggctatgccctgtatggtagtgct
acgctggttgccctctccacagggcaaggagtggactgcttcatgcttgatccgggtctc
ggtgaatttattttggtggacaaagatgttaaaatcaagaagaaggggaaggtatacagt
ctcaatgaaggttatgccaagtattttgatcctgcaatgacagaatacttgcaaaggaag
aaattccctgaggatggcagctccccatacggtgccaggtatgtgggctccatggtagct
gatgttcaccgtacactgatgtatggtgggatcttcatgtatcctgctaaccagaagagt
cctaaaggaaagctccgacttctctatgaatgcaaccctatggctttcatcattgagcag
gcaggtggaatggcaactacagggaccaaagcagtgttggatgtgaaacctgagaatatt
caccagagagttcctctcatacttggctctccagatgatgtgcaagaataccttgattgt
gttcagaaacaccagaagagcagctaa

DBGET integrated database retrieval system