KEGG   Cyanistes caeruleus (blue tit): 111945349
Entry
111945349         CDS       T05602                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00230  Purine metabolism
ccae00240  Pyrimidine metabolism
ccae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111945349
   00240 Pyrimidine metabolism
    111945349
Enzymes [BR:ccae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     111945349
SSDB
Motif
Pfam: dNK AAA_18 Thymidylate_kin
Other DBs
NCBI-GeneID: 111945349
NCBI-ProteinID: XP_023803798
Position
Unknown
AA seq 184 aa
MLYDKPTRWAYTFQTYACLSRVKAQLKPVSAKLLEAEHPVQFFERSVYSDRYVFASNLFE
SGNINETEWSIYQDWHTWLLNQFQSDIELDGMIYLRTTPQKCMERLQMRGREEEQGIELE
YLENLHYKHETWLHERTMRVDFENIKEIPILVLDVNEDFKNDKIKQEYLTDKVKSFLTSL
EDEN
NT seq 555 nt   +upstreamnt  +downstreamnt
atgctgtatgacaaacccacaagatgggcttacacatttcagacttacgcctgcttgagc
cgagtaaaagcacaattaaaacctgtctcagccaagctacttgaagcagaacatccagtg
caatttttcgagagatctgtatacagtgacagatacgtatttgcttctaacctgttcgag
tctggaaacattaatgaaacagagtggtctatttatcaggactggcacacatggcttttg
aatcagtttcaatcagatatagaactggatggcatgatctatctcagaaccacacctcag
aaatgcatggaaagactacagatgaggggaagagaagaggagcaaggaattgagcttgag
tatttggaaaacctccactataaacatgaaacctggcttcatgaaaggactatgagagtt
gattttgagaacattaaggagattcctattctagttttggatgttaatgaagattttaag
aatgataaaattaaacaagagtacttaactgataaagtcaagtcgttcctgacttctttg
gaagatgaaaattaa

DBGET integrated database retrieval system