KEGG   Cajanus cajan (pigeon pea): 109788945Help
Entry
109788945         CDS       T04868                                 

Definition
(RefSeq) tyrosine/DOPA decarboxylase 2-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00350  Tyrosine metabolism
ccaj00360  Phenylalanine metabolism
ccaj00380  Tryptophan metabolism
ccaj00950  Isoquinoline alkaloid biosynthesis
ccaj00965  Betalain biosynthesis
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    109788945
   00360 Phenylalanine metabolism
    109788945
   00380 Tryptophan metabolism
    109788945
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    109788945
   00950 Isoquinoline alkaloid biosynthesis
    109788945
   00965 Betalain biosynthesis
    109788945
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109788945
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     109788945
    4.1.1.105  L-tryptophan decarboxylase
     109788945
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109788945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 109788945
NCBI-ProteinID: XP_020203397
Position
Unknown
AA seq 502 aa AA seqDB search
MNPLDPKEFGRQGHMIIDFLADYYQNIANYPVLSQVEPGYLRKLMPSFAPLNPEPIETIL
QDLHQHIIPGITHWQSPNYFAYFPSSGSTAGFLGEMLSTGFNSVGFNWVSSPAATELENT
VMDWLGQVLNLPRDFLFSGSGGGVLLGTTCEAILVTLVAARDQILSQIGRENIGKLVVYV
SDQTHCAVQKAAHVIGIHPTNLRVIKTMKSTSFTLLPEPLLSAIQTDVQNGLVPCYVCVT
VGTTSTTAIDPLGPLCKVAKEYAMWVHVDAAYAGSVCICPEFRHLIDGVEGANSFSLNAH
KWFLTNLDCCCLWVKDPTSLVKSLSTHSVYLENSASDSKQVVDYKDWQITLSKRFRALKV
WLVLRSYGVANLRSWLRSHVEMAKTFEELVRQDKRFEIFVPRNLALVCFRLIPSAVAKIG
NGKVQNGHLKTEDVANEINRKLLDSINGSGTVYMTHAIVGGVFIIRCAIGATLTEKMHVI
MAWKVVQERADAILNYRKMNSS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctttagatccaaaagaattcgggaggcaagggcacatgataattgacttcctt
gctgattattaccagaatattgctaactatccagtcttgagtcaagtagagcctggttat
ctcagaaaactcatgccttcttttgcccccctcaatcctgaaccaattgaaaccatcctt
caagatttgcatcaacacataatccctggcataacacactggcaaagccctaattacttt
gcttactttccctccagtggcagcactgcagggtttctgggtgagatgctgagcacagga
ttcaactcggtggggttcaattgggtgtcttcaccagcagccacagagctagaaaacact
gtcatggattggcttggccaggtgctgaatctccctagggattttctcttttcaggtagt
ggtggaggtgtgttgttaggtacgacttgtgaggccattttggtcacactagttgctgct
agagatcaaatacttagccaaattggtagagaaaacatagggaagctagttgtttatgtc
tctgatcaaacacattgtgctgttcagaaagctgctcatgtaataggaattcaccccaca
aatttgagggtcatcaagactatgaagtcaacttcattcactttattgccagaaccattg
ttatctgctattcaaacagatgttcaaaatgggttggttccttgttatgtttgtgtcact
gtgggcacaacctcaaccactgcaattgatccactaggaccactgtgcaaggtggcaaaa
gaatatgccatgtgggtccatgttgatgctgcttatgctggaagtgtgtgtatttgtccc
gagttcagacacttgattgatggagttgagggtgcaaactcgtttagtctcaatgctcac
aaatggtttctaactaacctagattgttgttgtctttgggtgaaggatccaacttctttg
gtgaagtccctatcaacacattcagtgtacttggagaacagtgcttctgactcaaagcaa
gtggtggactacaaggattggcagataaccttgagcaaaagatttcgtgcactgaaagtt
tggcttgttcttcgaagctatggtgttgctaatcttagaagttggctcagaagccacgtt
gaaatggccaaaacttttgaggagttagtgaggcaggataagaggtttgagatttttgta
cctagaaatcttgctttggtctgctttaggcttataccatcagcagttgcaaagattggt
aatggcaaggtccaaaatggacacctcaaaaccgaggatgttgcaaatgaaatcaatcgt
aagttgcttgattccatcaatggttcaggcactgtatacatgactcatgctattgttgga
ggggttttcattattaggtgtgccataggagcaactttaactgaaaaaatgcatgtcatc
atggcctggaaggtggtgcaggaacgtgcagatgctattctaaactacaggaaaatgaat
tcttcttaa

DBGET integrated database retrieval system