KEGG   Cajanus cajan (pigeon pea): 109793729Help
Entry
109793729         CDS       T04868                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 1 isoform X1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00260  Glycine, serine and threonine metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    109793729
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     109793729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Pyridoxal_deC Aminotran_3 Cys_Met_Meta_PP Aminotran_5
Motif
Other DBs
NCBI-GeneID: 109793729
NCBI-ProteinID: XP_020208785
Position
2
AA seq 372 aa AA seqDB search
MVAENHYYFSVQERMVARNVDLRSDTVTKPTEAMRIAMANAEVDDDVLGNDPTAFLLETE
MARMMGKEAALFVPSGTMGNLICVLVHCDVRGSEVILGDNCHIYIYENGGIATIGGVHPR
AVKNNDDGTMDIDLIEAAIRDPRGELLYPTTRLICLENTHANSGGRCLSVEYTDRVGEIA
KKHGLKLHIDGARIFNASVALGVPLDRLVQAADSVSVCLSKGIGAPVGSVIVGSKNFIAK
ARRLRKTLGGGMRQIGILCAAALVGLQENVGKLESDHRKARLFADGLNEIKGLKVNASSV
ETNMIFIDIEEGTRTRAEKICKYLEERGVYVMQECSSRLRVVLHHQISASDVQYALSCFK
IALKGLQNETGN
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggtggcagagaatcattactacttttcagttcaagagaggatggtagctagaaatgtg
gatcttcggtcagacacggtgacaaagccaactgaagcaatgcgaattgctatggcaaat
gctgaagttgatgatgatgttctaggcaatgatccaactgcttttctcttagaaacagag
atggcaaggatgatgggcaaggaagctgctctttttgttccatctggcactatggggaac
cttatttgtgtacttgtccattgtgatgtcaggggaagtgaagttattcttggagacaat
tgccatatctatatttatgagaatggaggcattgcaactattggaggggtgcatccaaga
gcagtgaaaaataatgatgatggaaccatggacattgatttgattgaggctgctatcagg
gacccaaggggggagctactgtatccaaccaccaggcttatttgcttggaaaatactcat
gcaaactctggtggcagatgcctctcagttgaatatacagacagagttggagagatagct
aagaagcatggactgaagcttcacattgatggagcccgcatttttaatgcatcagttgca
cttggtgttccactggataggcttgtccaagcagctgattcagtttctgtttgcctatct
aaaggtataggtgctccagttggatctgttattgttggttccaagaattttattgccaag
gctagacgactccggaaaaccttaggaggtggaatgagacagattggcatcctttgtgct
gctgcacttgttggcttgcaggaaaatgttggaaagctggaaagtgatcacagaaaagct
agactttttgctgatggattgaatgaaattaaaggactgaaagtgaatgccagttctgtg
gagaccaatatgatatttatcgacattgaagagggtacacggactagagcagaaaagata
tgcaagtacttggaagaacgtggtgtctatgttatgcaagagtgctcatcaagattgaga
gttgttctccaccaccaaatatcagcaagcgatgtgcaatacgccttgtcatgctttaag
atagctctcaagggattgcagaatgaaacgggcaactag

DBGET integrated database retrieval system