KEGG   Cajanus cajan (pigeon pea): 109796579Help
Entry
109796579         CDS       T04868                                 

Definition
(RefSeq) probable phosphopantothenoylcysteine decarboxylase
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00770  Pantothenate and CoA biosynthesis
ccaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    109796579
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     109796579
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-GeneID: 109796579
NCBI-ProteinID: XP_020211841
Position
1
AA seq 211 aa AA seqDB search
MAGSEPVSAEGENMAVDAVPRKPRILLAASASVAAIKFANLCHCFSEWADVKAVATSASL
HFIDRASMPKDVILYTDEDEWSSWTKLGDSVLHIELRKWADIMVIAPLSANTLAKIAGGL
CDNLLTCIVRAWDFNKPFFVAPAMNTLMWNNPFTERHLIGIDELGISLIPPVTKRLACGD
YGNGAMAEPSTIYSTVRLFYESKAQQGNGDI
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggctggctcagaacctgtaagtgcagaaggagagaatatggcagtggatgctgtgcca
aggaagccccggattctacttgctgctagtgcgagtgttgctgctatcaaatttgcaaat
ctttgtcattgtttctctgaatgggcggatgtaaaagcagttgccacaagtgcatctttg
catttcattgatagagcttcgatgcctaaggatgtaattttatacacggatgaggacgaa
tggtctagttggacgaaactaggcgatagcgtgcttcacattgagcttcgcaaatgggct
gatatcatggtcattgctccattatcggccaacacccttgcaaagattgctggagggttg
tgtgacaatctactgacatgcatcgtgcgagcctgggacttcaacaagccattctttgtt
gctccagccatgaacactcttatgtggaacaatcctttcactgagcggcatctcattggc
attgatgagcttggcatttctctcattccacctgttacgaagaggttagcatgtggggat
tatggcaatggtgccatggctgaaccttctaccatttactcaactgtaaggctcttctat
gagtcaaaggctcagcaaggtaatggtgatatctga

DBGET integrated database retrieval system