KEGG   Cajanus cajan (pigeon pea): 109797609Help
Entry
109797609         CDS       T04868                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK7 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
ccaj  Cajanus cajan (pigeon pea)
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccaj01001]
    109797609
   01009 Protein phosphatases and associated proteins [BR:ccaj01009]
    109797609
Enzymes [BR:ccaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109797609
Protein kinases [BR:ccaj01001]
 Serine/threonine kinases: Other
  Wnk family
   109797609
Protein phosphatases and associated proteins [BR:ccaj01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109797609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Kdo
Motif
Other DBs
NCBI-GeneID: 109797609
NCBI-ProteinID: XP_020213291
Position
3
AA seq 664 aa AA seqDB search
MSLTESEFSEEGAAGLQEPPDPNVIEIDPTSRYIRYKEVIGKGAFKTVYKAFDEINGLEV
AWSQVQIDEVLQSPGGLERLYSEVRLLKTLKHDNIVKFYNSWIDEKHRNLNLITELFTSG
SLRQYSQKHKKVDMKAIKGWARQILMGINYLHSHNPPVMHRDLKCDNIFINGHRGEVKIG
DLGLATLLKQTNAKSVIVGTPEFMAPELYDEHYNELADIYSFGMCMLELVTSEYPYRECR
NSAQIYKKVSSGIKPAALARVKDPEVKLFIEKCLVPAPQRSSAKELLMDHFLQVNGSLKN
RRLPLPDIVLPKYGAFEHRCLMSEGPASTRVRSISMDLGDATELPLTTLVYNSVDSVNDT
SSSPCVEIRRLNEGDRFFLKGEENDENSVSLVLRISDQSGRARNIHFIFYLDSDSAISVS
SEMVEQLELSEQSVKFIAELIDLLLITLIPNWKPCVAIDHLVSCTGKLTHPSQRKESELA
KHRVNSEDFSENVAEDVGSSTSPGRSEEKENHDTVIFHEVLSQASNDFQRAIKKDDFCSD
ISYTSETSDFNDKHFSTVSFMSAKSGFTDCDLPKVNSQCSLASEMGASPDYRCKLPCLES
NGIMKSFNYPTSASCSCEHEDEFKIELEMIEQQYQDAIKELSKRRYQAIAETSRRLSQKY
ASIK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgacagaatcagaattctcagaggagggtgcagcaggccttcaagagcctcct
gatcccaatgttattgaaattgatcccactagtcgctatattaggtataaagaagtcatt
ggcaaaggagctttcaagactgtttacaaggcatttgatgaaatcaatggacttgaagtt
gcatggagccaagttcagattgatgaggtattacagtcaccaggtggcctagagaggctg
tactcagaagtacgtcttttgaagacactgaagcacgataacatagtaaagttctacaat
tcttggatcgatgaaaagcacaggaatcttaacttgataactgagttgttcacctcaggg
agccttagacagtatagtcagaaacacaagaaggttgacatgaaggctatcaaaggatgg
gcaaggcagattttaatgggtataaactatctccactctcacaacccacctgttatgcat
agggacctgaagtgtgataatatatttattaatggtcaccggggagaagttaaaattgga
gatctagggttggcaactttgttgaagcagactaatgccaagagtgtaattgtaggaacc
ccggagttcatggcacctgaactgtatgatgaacattataatgaattagccgacatatat
tcttttgggatgtgcatgcttgagttggttacgtctgaatatccttaccgtgaatgtaga
aactcagctcagatatacaagaaagtttcatctggcataaagcctgctgcacttgccaga
gtcaaagatccagaagtaaaattatttattgagaaatgtcttgtcccagcacctcaaaga
tcgtcagcaaaggagcttctgatggaccattttctccaagtgaatggttcgttgaagaat
cgtcgtcttccattaccagatattgttcttccaaaatatggagccttcgaacatcgttgt
ctgatgtcagaaggtcctgctagtacacgtgttagatccatttcaatggatcttggtgat
gccactgagcttccattgaccactttagtttataactctgttgattctgttaatgataca
tcatcttccccttgtgttgagatacgaaggttgaatgaaggtgacagattttttctaaaa
ggcgaagaaaatgatgaaaactcggtgtcattggttctccgcatatctgatcagagtggg
cgagcaagaaatatccatttcatattctacctcgacagtgattctgccatctcagtttca
agtgaaatggttgagcaactagaactttctgagcaaagtgttaaattcatagcagagtta
attgatctattattgataactttgattcccaattggaaaccttgtgtagcgattgatcat
ttagtttcttgtactggtaaactaactcatccgagtcaacggaaagaatcagagttagca
aaacacagagtaaactcagaagattttagcgaaaatgtggccgaagatgtaggttcctca
acctcaccaggaagatcagaagaaaaggaaaaccatgatactgtgatttttcacgaggtt
ttgtctcaagcaagcaatgattttcaaagagcaataaagaaagatgatttttgttctgat
atttcatacacttctgaaacatctgacttcaatgataagcatttttctacagtttcattc
atgtctgctaaatcaggatttacagactgtgacttgcctaaagttaatagtcaatgctca
cttgcttctgaaatgggggcatcacctgattataggtgtaagttgccatgcttagaaagc
aatggtataatgaaatcctttaattatcccactagtgcttcttgctcgtgtgaacatgag
gatgagttcaaaatagagttagaaatgattgaacagcagtatcaagatgcaattaaagaa
ttatcaaaaagaagataccaggccatcgcagagaccagcaggagactgtcacaaaaatat
gcaagcataaaataa

DBGET integrated database retrieval system